Vacations in Dubai
Search hundreds of travel sites at once for vacation package deals in dubai.
Let KAYAK do the searching
Save on your next vacation
Search and compare hundred of travel sites at once for vacation packages in Dubai
We’re completely free to use - No hidden charges or fees
Filter by free cancellation, free breakfast and more
Cheap Dubai package deals
Most popular dubai flight and hotel deals, all inclusive vacation packages to dubai, last minute vacation packages to dubai, search by stars, search by review score, search by board, search by price, search by freebies, when to book a vacation in dubai, tips for finding dubai package deals.
- There are loads of types of vacations in Dubai and the cost will depend on what type of trip you’re taking and for how long you’d like to stay. Here are the latest prices for a 3 night trip for 2 travelers: Top vacation $666; Family vacation $593; Romantic vacation $805; Luxury vacation $759; Budget vacation $462.
Why should you book a vacation package to Dubai?
With a good Dubai vacation package, you can experience this Persian Gulf emirate's famous 4X4 Desert Safaris and races, visit the Burj Khalifa, skydive over the world-famous Palm Jumeirah Island or take your kids to the Dubai Sky Polar pass or Dubai Atlantis Aquaven
When should you book a vacation package to Dubai?
The winter season in Dubai is the perfect time to take a vacation on the white sands of the Persian Gulf. From November to March it's the rainy season, which is the only cool period. The rains are short lived, however. Book your stay in advance to get the best Dubai package deals.
Where should you stay in Dubai during your vacation?
For any vacation type in dubai:.
Rove Downtown Dubai "is made for social media." The special hang out lounge features comfy sofas, a wall full of artworks and an eclectic collection of bric-a-brac. Many of the spacious rooms feature interconnecting doors perfect for families, 48-inch interactive TV screens, sofa beds for extra guests, a mini fridge, secure safe and in-room coffee and tea stations.
Located at the further end of Dubai Marina, Grosvenor House is a sophisticated twin tower hotel designed with marble floors, plush carpets, and mahogany furnishings. It's famous for offering the best Asian spa, heated pools, free spacious parking, a superb club lounge, airport transfers and shuttle bus services, and more.
For family vacations in Dubai:
The JA Jebel Ali Beach Hotel is a family-friendly resort located on the shores of the Persian Gulf. It offers a 9-hole golf course and horse riding. The breakfast-inclusive stays give your family access to temperature controlled swimming pools, shuttle bus services, and airport transportation.
Popularly known as the "House By The Sea," the Beit Al Bahar stand-alone villas offer complete privacy for your family. The hotel offers bed and breakfast, shuttle bus services, dry cleaning services, WiFi and room service, and is located in Jumeirah St next to the Wild Wadi Waterpark.
For romantic vacations in Dubai:
Located at the entrance to Jumeirah Island, the FIVE Palm Jumeirah Dubai Hotel is the perfect hideout for couples who want to reignite their passion and create their own epic stories at the beach while sharing inspiring moments. The hotel has a contemporary architectural design, has shuttle bus services, airport transfers, hot tub and air conditioning in all rooms, as well as plenty of parking space.
Atlantis, the Palm Hotel is a gem of sheer beauty located off Crescent Road. Atlantis provides breakfast, airport transportation, and dry cleaning services. The award-winning chef restaurants, aquarium and waterpark, and the Ocean Deluxe rooms are a must experience for couples.
For luxury vacations in Dubai:
With rotating beds that have a view of the city, the Burj Al Arab is the most luxurious hotel in Dubai. The opulent interiors are designed with towering golden pillars and stairs made of marble and gold. The hotel's Dubai travel package gives you the opportunity to arrive by helicopter, experience VIP services and have a 24-hour private butler.
The one and only Palm Dubai offers peace and tranquility in Dubai's breathtaking western portion of the Palm. Enjoy the bed and breakfast, Moorish and Andalusian design terraces and balconies or a suite with a private plunge pool.
For budget vacations in Dubai:
City Max Hotel Bur Dubai offers value for money comfort with breakfast, in-room refrigerators, access to an outdoor pool and free parking included in its Dubai vacation packages
Located a few meters from Dubai Creek, the 4-acre Arabian Park Hotel offers free and ample parking, an outdoor pool, bar/lounge, quiet surroundings, a shuttle bus service, and transport to and from the airport.
Where to stay in Dubai
Dubai vacation information, other popular package vacation destinations.
- Boston package vacations
- Bermuda package vacations
- Saint Lucia package vacations
- San José del Cabo package vacations
- Phoenix package vacations
- Atlanta package vacations
- Dublin package vacations
- Saint Thomas Island package vacations
- Belize package vacations
- Nashville package vacations
Expedia Rewards is now One Key™
Dubai Vacations & Trips from $1,334
Book a hotel + flight or car together to unlock savings.
- Things to do
I only need accommodations for part of my trip
- payments icon Better together Save up to $580 when you book a flight and hotel together*
- lob hotels icon Find the right fit With over 300,000 hotels worldwide, it's easy to create a perfect package
- lob packages icon Rest easy Plan, book, and manage your trip all in one place
Your Dubai Vacation
For a glitzy, glamorous vacation package deals, Dubai it is. This glossy desert oasis is the perfect stopover en route to Asia and an incredible destination all on its own. Start building your perfect vacation package to Dubai by choosing a luxurious hotel in the city—maybe a spot on The Palm or high in the iconic Burj al Arab, or a resort along Jumeirah Beach. Each one has activities galore: dune buggying in the desert, shopping in the Gold Souk, or dancing at a rooftop bar—and that’s just scratching the surface.
Top destinations in Dubai
The Latest Dubai Vacation Packages
Address Beach Resort
Reviewed on Mar 20, 2024
Burj Al Arab Jumeirah
Reviewed on Mar 22, 2024
The Retreat Palm Dubai MGallery by Sofitel
Reviewed on Feb 26, 2024
Hyatt Regency Dubai
Reviewed on Apr 10, 2024
The Biltmore Hotel Villas
Where to stay in dubai.
Palm Jumeirah
Discover an archipelago of artificial islands featuring recently opened destinations like The Pointe, Club Vista Mare, and Nakheel Mall. Enjoy various hotels, resorts, and hotel residences, while exploring retail and dining options, all connected by the Palm Jumeirah Monorail.
Downtown Dubai
Home to iconic landmarks like Burj Khalifa and The Dubai Mall, this mixed-use complex offers luxury shopping, an Olympic-size ice rink, and a variety of dining options along Sheikh Mohammad bin Rashid Boulevard.
Dubai Marina
Artificial canal city boasting the world's largest human-made marina, featuring Dubai Marina Mall with 140 retail outlets, and The Walk at JBR for dining. Enjoy Marina Promenade views and access Al Sufouh Tramway for easy transport.
Jumeirah Beach Residence
Waterfront community in Dubai Marina, Jumeirah Beach Residence boasts 40 towers, The Beach retail complex, and a 1.7-km strip called The Walk. Enjoy views of Ain Dubai on Bluewaters Island and easy access to Dubai Marina, Dubai Tram, and Dubai Metro.
Historically significant, this district boasts centuries-old gold and spice souqs, ancient forts, and iconic structures. Shop at City Centre Deira mall, explore the Waterfront Market, or take a boat across Dubai Creek.
Dubai Essential Information
Prepare for your dubai vacation with our essential travel info, dubai hotel deals.
Reviewed on Apr 19, 2024
Reviewed on Apr 16, 2024
Explore other types of vacation packages
All Inclusive Vacations
Beach Vacations
Kid Friendly Vacations
Golf Vacations
Luxury Vacations
Romantic Vacations
Ski Vacations
Where to go when
Frequently asked questions, discover the most popular places to visit in dubai, burj khalifa.
The tallest man-made structure on earth is a city in the sky that houses luxury apartments, offices and a hotel.
Browse, shop, play and dine at one of the largest shopping and entertainment malls in the world.
Marina Beach
Nothing says vacation like spending a lazy day at Marina Beach, a popular beach in Dubai. Stroll along the marina or attend a sporting event in this family-friendly area.
What to do in Dubai
Dubai: desert safari with bbq dinner & quad biking options, dubai: desert safari with vip bbq and optional quad bike, atlantis dubai: aquaventure waterpark & lost chambers aquarium combo ticket, other vacations you might like.
- Top cities in Dubai
- Vacations and getaways similar to Dubai
- Best vacation destinations by month
- Expedia's Latest Trends
- Hatta Vacations
- Murqquab Vacations
- Al Awir Vacations
- Abu Dhabi Vacations
- Fujairah Vacations
- Ajman Vacations
- Umm al-Quwain Vacations
- January Vacations and Deals
- February Vacations and Deals
- March Vacations and Deals
- April Vacations and Deals
- May Vacations and Deals
- June Vacations and Deals
- July Vacations and Deals
- August Vacations and Deals
- September Vacations and Deals
- October Vacations and Deals
- November Vacations and Deals
- December Vacations and Deals
You can unsubscribe at any time. Please see our Privacy Policy .
COUNTRYPICKERWESELECTEDHEADERMESSAGE
COUNTRYPICKERWESELECTEDMESSAGE click here
Cookies: We use cookies to improve your experience on this website. By continuing to browse our website, you are agreeing to use our site cookies. Please read more here
Choose your country and language
- The Americas
- The Middle East
- Asia & South Pacific
- All Inclusive Offers
- Athens Vacations
- Early bird offers
Dubai Vacations
- Last Minute Escapes
Maldives Vacations
- Milan Vacations
- Upgrades & More
Featured Destinations
Middle east.
- Ras Al Khaimah
Indian Ocean
- Philippines
- South Korea
- South Africa
- All-Inclusive Vacations
- Beach Vacations
- Business Class Vacations
- Family Vacations
- Ultimate Luxury
- Wellness Vacations
- Egypt - Splendours of the Nile
- India - Golden Triangle Tour
- Italy - Milan and Lake Como
- Jordan - Jordan Explorer Tour
- South East Asia
- Sri Lanka - Serendib Explorer
- COVID-19 Hub
- Pay My Balance
- 1-855-358-1505
- Flight + Hotel
Search Holidays
- Manage My Booking
Introduction
At a glance, when to visit, what to pack, areas of dubai, attractions.
The speed of Dubai’s metamorphosis is unparalleled, creating a thriving metropolis in the heart of the desert in less than half a century. Many people are likely to be dazzled by the whiteness of the sand and the scale of the skyscrapers, but it’s also still possible to step back in time with a desert safari or boat trip on the creek.
Dubai vacations are even more memorable, when you are soaking up the sun on the beaches of Dubai or enjoying limitless culinary delights in award-winning Michelin starred restaurants, some with awe-inspiring iconic views of the city or watching your sporting heroes take part in some of the most prestigious international sporting events around the year. Alternatively, shop till you drop in any one of Dubai's 96 malls or souks. Be there in Dubai for the vacation of a lifetime.
If you're looking to relax completely, knowing that everything is taken care of even before you travel, we recommend a Dubai all-inclusive vacation! With all your meals and drinks paid for, when you book these offers with Emirates Vacations, you can look forward to a stress-free holiday in the sun.
Book today and enjoy guaranteed savings , low deposits from $199, complimentary upgrades and many more extras to make your next vacation truly unforgettable. Call us on 1-855-358-1505 for further details and to book.
Emirates gateway: Dubai International Airport
Time zone: GMT + 3 hours
Currency: Emirati Dirham. Currency is easily exchangeable beforehand. ATMs are plentiful and credit cards widely accepted
Languages: Arabic, with English is widely spoken
Dialing code: +971
Religion: Islam
Plug sockets: 240 volts AC, 50Hz. British-style plugs with three pins are standard
Transfers from Dubai Airport to Dubai City: 20 to 30 minutes
Transfers from Dubai Airport to Jumeirah Beach/Jumeirah Beach Residence: 40 to 50 minutes
Transfers from Dubai Airport to Palm Jumeirah, Jebel Ali or desert: 50 to 60 minutes
From beaches that fringe the warm waters of the Arabian Gulf bathed in year-round sunshine, to the architectural marvels that punctuate the skyline and define the destination, Dubai is irresistibly dynamic, with some of the world’s most unique and modern attractions.
- Wander the laneways of the atmospheric gold and spice souks of old Dubai, piled high with aromatic and glittering treats.
- Check out super-cool Kite Beach if you’re into watersports.
- Have hours of laughs and squeals while cooling down at Dubai’s water parks.
- Visit Downtown Dubai, packed with incredible sites, including an actual dinosaur skeleton inside a shopping mall and the highest building on the planet, Burj Khalifa.
Expect year-round sunshine – it’s just a case of exactly how hot you like it. October to April provides the most pleasant option (small potential of rain and wind in January and February), with temperatures around 25-28C. From May, these temperatures really rocket between June and September (upwards of 40C) but Dubai offers plenty of incentives to visit then, such as shopping festivals in air-conditioned malls, indoor attractions and fantastic value offers.
These high temperatures require light, breathable clothing, but always have a cover-up for when you hit the air conditioning. Whilst a liberal and popular holiday hotspot, it’s still good to bear in mind that Dubai is a Muslim destination, so dress respectfully outside of your resort (for example, women should wear clothing that covers the shoulders and the knees in shopping malls, and if entering a mosque, hair must be covered). Desert trips are best in comfortable safari-type clothing.
Palm Jumeirah
This ambitious artificial archipelago, created using land reclamation, was one of many projects that put Dubai on the map, with its crescent-like “fronds” extending out from a “trunk” that runs the length of the central section – all the way from the mainland up to Atlantis The Palm. The 5.4km Palm Jumeirah Monorail also runs from the Gateway Towers at the base to Atlantis The Palm and is home to many thousands of private homes, and numerous hotels by some of the world’s leading brands, such as Fairmont, Sofitel, Jumeirah, One&Only, Waldorf Astoria and Anantara.
Jumeirah Beach
One of the original homes of tourism here in the emirate, Dubai’s main beach area is washed by the warm waters of the Arabian Gulf and lined with excellent hotels, such as the iconic wave-like Jumeirah Beach. Also here is Wild Wadi WaterparkTM, which will keep everyone amused for hours, while Jumeirah beach park is a great public space that’s also popular with local families.
Downtown Dubai
The anchor of this futuristic district is the Burj Khalifa, the world’s tallest building, which took five years to build and opened in 2010, boasting a staggering 828 metres to its name; from the viewing area at its upper levels, other buildings below seem like crumbs. Inside the Burj Khalifa is the first-ever Armani hotel, while other attentiongrabbing attractions of this area include Dubai Mall and Dubai Fountain - both the world’s biggest - where jets of water shoot up to 150 metres high, and seem to “dance” in time to music as they are illuminated by more than 6,000 lights.
Sitting on the south side of Dubai Creek, the oldest part of the city dates to the 1900s, with sandy-coloured buildings, museums and minarets. Here you’ll see Al Fahidi Historical Neighbourhood with its charming car-free, narrow streets and houses topped with wind towers, or barajeel. The area was previously known as Bastakiya after the Iranian town of Bastak, where the original Iranian settlers came from across the Gulf to take advantage of free land and low taxes. You can find out more about Dubai’s history with a look inside Dubai Museum or browse the rainbow of fabrics, clothes and slippers in the Textile Souk.
Sheikh Zayed Road
Named for the much-revered first president of UAE, this is where life has spread out to from the Creek, and has been the epicentre of development, amassing a collection of skyscrapers each more audacious than the next, such as Emirates Towers. Technically, it’s just part of the highway running across the whole of UAE, but it’s also where you’ll find many of the city’s hotels, restaurants and shops. For example, just some of the junctions off here will take you towards Mall of the Emirates, Gold & Diamond Park, Madinat Jumeirah, Burj Al Arab, Wild Wadi Water Park™, Downtown Dubai, Burj Khalifa, Dubai Mall and Dubai Marina.
Wander one of the city’s oldest districts, dating to around 1841. Once just a sleepy waterside village, Deira soon took over the original settlement of Bur Dubai in scale and is still a cornucopia of ethnicities mixed with tourists, here to check out the souks, where gold is among the cheapest in the world. You can cross Dubai Creek between Deira and Bur Dubai in an ‘abra’ (water taxi) for just AED2 (approximately 40p).
Dubai Marina
Sophisticated, skyscraping, and buzzing – Dubai Marina is designed to evoke Riviera-style living in a contemporary setting. This attractive and central place to play and stay in Dubai is a waterfront development built around a 3.5km canal. Along its banks are Dubai Marina Mall (with around 140 stores); The Address Dubai Marina hotel; Pier 7 Dubai Marina - which boasts seven restaurants, each on its own floor and with a unique atmosphere; and Dubai Marina Yacht Club.
Mall of the Emirates/Al Barsha
Now 11 years old, this place changed the face of shopping in Dubai forever. Billed as the world’s first shopping “resort”, it is a destination in its own right, home to Ski Dubai, hundreds of shops, two hotels including Kempinski Mall of the Emirates, Magic Planet for family entertainment, a 14-screen VOX Cinema, Dubai Community Theatre and Arts Centre and more than 90 dining options. Al Barsha the residential area surrounding the mall offers affordable accommodation and local dining options close to many of Dubai’s key attractions.
No trip to Dubai would be complete without a desert safari. Hop into a 4x4 and leave the city behind as you head into the wilds of the desert - go dune ‘bashing’ or camel-riding before sunset, then enjoy remote Bedouin-style camps with fireside tales and delicious dinners, or even spend the night sleeping out in tents before returning to Dubai after breakfast.
Jumeirah Beach Residences
This area combines casual outdoor living with top-notch shops, restaurants and the beach. The Walk at JBR, which was Dubai’s first outdoor promenade, has a 1.7km stretch of shops and restaurants and more recently has also been joined by The Beach, with even more dining and leisure options formed around a pedestrian esplanade.
Jebel Ali is the thriving commercial port area of Dubai, around 35km southwest from the city, and given its historic establishment, can also boast one of the most longstanding and largest resorts in the emirate – the JA Jebel Ali Beach Resort, which has a lovely private beach, golf course and a myriad of other leisure attractions. Jebel Ali is also the new home of a dazzling new attraction - Dubai Parks & Resorts. This is the first integrated resort destination in the region, opening in late 2016, and home of LEGOLAND® Dubai, LEGOLAND® Waterpark, motiongate™ Dubai and Bollywood Parks™, as well as Riverland™.
International restaurants and top global chefs are in abundance, but if you want to try Emirati cuisine, you’ll sense a range of regional influences. Most likely, you will find roast lamb with rice and nuts (ghuzi), stuffed vine leaves (warak enab), chickpea and sesame paste (hummus), bulghur wheat with mint and parsley (tabbouleh), spit-cooked meat in pitta bread with garlic sauce (shawama), cooked balls of chickpeas with herbs (falafel) and plenty of fish. Goat may also be on the menu, but no pork, in accordance with Muslim beliefs. Alcohol is tolerated and drinking is possible in the plentiful hotel bars and restaurants.
Culture in Dubai is rooted in Islamic traditions. Emirati men tend to dress in traditional dishdasha or khandura (long white shirt-dress), with ghutra (a white headdress) and agal (a rope worn to keep the ghutra in place), while women tend to wear an abaya (a long black cloak), with a sheyla or hijab (a scarf used to wrap around the face and head). The most religious time of the year is Ramadan, when Muslims fast for approximately a month and a festival atmosphere can be found in the evening when the locals break their fast. But as well as the minarets of mosques, you will also see temples and churches. A new opera house is also set to open this year.
Hares and lizards - such as the spiny-tailed lizard - may scamper around the desert but you would be hard pushed to see much natural wildlife in Dubai these days. However, there are many excellent reserves and conservation projects you can explore – which provide the thrill of seeing the iconic oryx, an Arabian leopard, mountain gazelle, sand gazelle or caracal. In the waters, you might have the chance of spotting the biggest fish of the ocean, a whale shark.
The human history of Dubai dates back to the bronze age (2500BC) when nomadic cattle herders are first thought to have settled in the area. A couple of millennia later and Dubai was still little more than a small fishing settlement until members of the Bani Yas tribe, led by the Maktoum Family, settled at the mouth of the creek in 1833. The creek was a natural harbour and Dubai soon became a centre for the fishing, pearling and sea trade. The population was later buoyed by the lure of tax-free living attracting traders from the Indian subcontinent. Oil was discovered in the 1950s and the first cargo left Dubai in 1969. In 1971, the six emirates agreed a Federal Constitution, gained independence from Britain becoming the United Arab Emirates, with Ras Al Khaimah joining the following year to form the UAE as it is today.
Aquaventure Waterpark
This adrenaline-pumping waterpark set within Atlantis The Palm includes the chance to take the Leap of Faith or zoom through the darkened tunnels of Shark Attack; as well as an invite to tackle Aquaconda, the world’s largest water slide. Or, perhaps you prefer to just sit and mind everyone’s towels as you relax on 700 metres of private beach. Ticket prices from E£ 1,253 per person.
At The Top, Burj Khalifa
This attraction is spread across levels 148 and 125 of Burj Khalifa, the world’s tallest building. The experience starts with the lift up to level 125, where you can marvel at the view from the 380-degree enclosed observatory. Then it’s up a little more, to the 148th floor at 555 meters, where you step onto the world’s highest outdoor observation deck. After all that sightseeing, visit Level 122 which is home to the restaurant and bar, At.mosphere. Ticket prices from E£ 797 per person.
IMG Worlds of Adventure
Dubai’s first mega themed entertainment destination will be the largest temperature controlled indoor park in the world and will wow guests with its four epic adventure zones. Two are created with global adventure brands Cartoon Network and MARVEL, while IMG Boulevard and the Lost Valley – Dinosaur Adventure are original concepts from the IMG Group. Think rollercoasters, thrill rides and attractions – all based on popular characters and hair-raising dinosaurs. Combine with the amazing array of retail temptations and exclusive dining venues and you have a day of fun for the whole family.
The brilliant KidZania® is a super-interactive and educational attraction inside The Dubai Mall where children play grown-ups as they try on various careers for size. There are more than 80 roles to choose from including firefighters, radio hosts, jewellery designers and mechanics. Ticket prices from E£ 683 per person.
Wild Wadi Waterpark™
One of the best family days out in Dubai, Wild Wadi Waterpark™ is set in front of the iconic Burj Al Arab Jumeirah, and offers 30 watery rides and attractions. Themed around the tale of Juha, a character from Arabian folklore, the rides range from sedate “lazy rivers” where you can bob along in a rubber ring, to the Jumeirah Sceirah, which has two tandem slides you zip down from a 32 metre high tower.
Dubai Aquarium
The 270-degree acrylic walkthrough tunnel takes you under one of the largest tanks in the world so you can see some of the 33,000 animals - representing more than 85 species including 400 sharks and rays. You can also just stroll past it from The Dubai Mall, with one of the world’s largest viewing panels to gaze through to the aquarium. Ticket prices from E£ 456 per person.
Seawings Seaplane Tours
There’s only one way to really get to grips with the scale of things here - from the air and these tours by seaplane do just that. Giving the finest views over Dubai, these comfortable little planes can use 27 different water landing strips and runways across UAE, so any combinations can be arranged. The 40-minute Dubai Silver Air Tour flies you over all the Dubai classics, taking off from either Dubai Creek or Jebel Ali Resort, then cruising along the coastline, giving you a bird’s-eye view of The World, Burj Khalifa and Burj Al Arab Jumeirah. Ticket prices from E£ 8,109 per person.
Situated within the Mall of the Emirates, this made the world sit up and take notice of Dubai’s many ambitious projects when it first opened – and still does. It was the Middle East’s first indoor ski resort and today offers a snow park, Ski School, Penguin Encounter and Snow Bullet. Ticket prices from E£ 615 per person.
SEGA Republic
One of the many attractions inside The Dubai Mall, SEGA Republic is a high-adrenaline, indoor family theme park, featuring 15 attractions and more than 170 games, from cutting-edge motion simulators to virtual experiences. Ticket prices from E£ 820 per person.
Dubai Parks and Resorts
Calling all adventure seekers, Dubai Parks and Resorts opened its doors in October 2016 and should be at the top of your must-visit list. Home to three world-class theme parks, one water park and over 100 attractions ranging from rollercoasters and waterslides to cinematic rides and live shows, Dubai Parks and Resorts is sure to delight guests of all ages. Lapita, a four star Polynesian style hotel is located within the parks and offers guests the convenience of a night’s rest only a few minutes from the rides. Located on Sheikh Zayed Road, opposite Palm Jebel Ali, a trip to this fun-filled resort is a great option for guests staying in Dubai or Abu Dhabi.
More To Discover
If you want to do more than “fly and flop”, you’ve come to the right place. One way to get the measure of Dubai is to catch it from the air – whether that be via an adrenaline-fuelled skydive over The Palm Jumeirah, or a scenic seaplane ride. Other aerial options include a sunrise hot air balloon experience, which will lift you off the ground 1,200 metres above the desert as you spot oases and the occasional wandering camel below. Kite surfers will love Kite Beach, one of Dubai’s best stretches of sand, and one where watersports operators aplenty await to help you pick up a new skill or hone your talent. Meanwhile at Dubai Mall, you can try a snorkeling cage experience within the huge tank at Dubai Aquarium, or even swim with sharks.
Explore more Indian Ocean Holidays
Mauritius Vacations
Seychelles Vacations
Sri Lanka Vacations
Join the emirates vacations community.
Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.
We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.
Why Emirates Vacations?
- Personalised holidays
- Support at every step
- Get more for your money
- Fly Better with Emirates
For more information, please click here
- Recent Hotels 0 You do not have any recently viewed hotels.
- Shortlist 0 Your hotel shortlist is empty!
- Recent Searches You do not have any recent searches
Please refresh this page
This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.
Dubai Tour Packages
Compare dubai tours & packages from top travel agents.
Oct 01, 2023: Global Village Dubai is open from 18 October 2023 to 28 April 2024 and Miracle Garden Dubai is open from 29th September 2023 to 30th April 2024.
Ideal Duration of Dubai Tour
Best time to visit dubai, dubai visa for indians, why should you buy a package for dubai, honeymoon in dubai.
A honeymoon in Dubai is the perfect romantic trip you could ever ask for. An urban jungle fused with traditional Arabic culture and cuisine, Dubai offers experiences ranging from thrilling adventures in the desert to the towering Burj Khalifa, luxury shopping and dining experiences in some of the best restaurants and souks. It also boasts some of the most luxurious hotels and resorts. Holidify’s Dubai honeymoon packages are customisable to suit every couple’s needs, whether there be a need for adventure, leisure or a bit of both.
Family Trip to Dubai
Dubai makes for one of the best cities for a family holiday with lots of attractions and activities for kids and adults alike. With Holidify’s Family Tours in Dubai, enjoy the Aquaventure waterpark, Lost chambers aquarium and the Dubai Aquarium and underwater zoo. The desert safari tour also can be enjoyed with camel rides, dune buggy rides and cultural performances over a delightful barbeque dinner.
The various beaches are hubs for watersports such as parasailing, banana boat rides, speed boats and more to keep the young ones engaged.
Things to Do in Dubai
Desert Safari with BBQ Dinner: Enjoy a thrilling safari across the mighty sand dunes with the sun glistening across the landscape. After sundown, enjoy a sumptuous traditional dinner coupled with a stunning dance performance. Dubai Shopping Festival: The Dubai Shopping Festival is a haven for all shopaholics coming to Dubai from the end of December until late January-early February. Visitors can enjoy a host of events, live shows by famous artists, sports and other fun family activities and gorge upon delicious cuisines all laid bare for the curious. In addition, the outdoor Bazaar and fireworks display with the recent addition of the Drone Show are not to be missed.
Dhow Creek Cruise: Cruise on a traditional wooden boat along the Dubai Marina, soaking in the urban architecture of the city, bathed in sunlight, night lights or even fireworks. A leisurely cruise suited for both couples and families, you can enjoy the cruise during the day, evening, or night and even pair it with a beautiful dinner. Skydiving: For those who enjoy the thrills of life and chase adrenaline rushes, skydiving is one of the best experiences we recommend. Falling from a height in groups or solo makes for a thrill that few other experiences can replicate. With some of the best instructors, be assured that your skydiving experience is in safe hands and will be one you remember forever.
Aquaventure Waterpark: Make a splash at Aquaventure Waterpark for a fun day enjoying various rides and games at the Atlantis Hotel. No family trip to Dubai is complete without visiting this popular water-themed park.
Places to Visit in Dubai
By purchasing a Dubai tour package, you can enjoy a seamless experience, cost savings, local expertise, exclusive experiences, reliable support, and cultural insights. These advantages enhance your overall trip, allowing you to make the most of your time in Dubai while overcoming the challenges that travelers may encounter.
Popular Dubai Packages
Price Range (per person)
Combined With
Starting From
Holidify connects you with top travel agents
Compare Custom Quotes and get the best package deal
1 .Trusted Network Of 3000+ Agents. 2 .Book everything together, including stay & transport. 3 .Compare agent profiles & verified reviews
How It Works?
Compare Custom Quotes from Top Travel Agents
1 .Tell us about your trip . 2 .Get Custom quotes from top agents. 3 .Choose the package you like
Choose any duration
Create your own customised package
Plan your trip to Dubai with the help of local experts
Choose hotel-type
Sightseeing & activities
All Transport Options
Meals & other inclusions
From Top Travel Agents
64 Dubai Tour Packages Found
Filter by duration
*Final price will be shared by our partner agents based on your requirements
Best Dubai Tour Package - Visit to Burj Khalifa Included
4 Nights / 5 Days
₹ 38,000* per person
₹ 38,000*
per adult on twin sharing
Dubai Essence Retreat Package for 3 Nights With Desert Safari
3 Nights / 4 Days
₹ 30,000* per person
₹ 30,000*
Dubai Luxe Escape for 6 Nights With Limousine & Yatch Ride
6 Nights / 7 Days
Dubai(6N) → Abu Dhabi(0N)
₹ 62,000* per person
₹ 62,000*
Expert Choice
Majestic Dubai Package with Abu Dhabi Day Tour: Ferrari World Included
5 Nights / 6 Days
Dubai(5N) → Abu Dhabi(0N)
₹ 45,000* per person
₹ 45,000*
Not sure which package to pick for Dubai?
Talk to our trip experts now to get the best deal
Your Email ID
Mobile Number
Dubai 5 Nights Family Package with Yas Island Tour
Dubai(3N) → Abu Dhabi(2N)
₹ 51,000* per person
₹ 51,000*
Trending Now
Splendid Dubai 4 Nights Package with Miracle Garden & Global Village
₹ 35,500* per person
₹ 35,500*
Dubai Honeymoon Haven Package: With Private Desert Safari
₹ 39,000* per person
₹ 39,000*
10 Days Dubai & Turkey Discovery Tour Package
9 Nights / 10 Days
Dubai(4N) → Abu Dhabi(0N) → Istanbul(3N) → Cappadocia(2N)
₹ 103,000* per person
₹ 103,000*
Offbeat Explorer
Experience the Best of Dubai and Thailand
8 Nights / 9 Days
Dubai( 3N) → Phuket(3N) → Bangkok(2N)
₹ 76,000* per person
₹ 76,000*
Dubai Atlantis the Palm Experience with Aquaventure Waterpark (1 Night Stay Included)
₹ 108,493* per person
₹ 108,493*
Dubai Tour with 4 Nights Stay at Gevora Hotel (Tallest Hotel)
₹ 39,400* per person
₹ 39,400*
All Of Dubai Tour Package with 4 Nights Stay at Royal Ascot
₹ 33,500* per person
₹ 33,500*
11 Day Turkey and Dubai Itinerary with Hot Air Balloon Ride
11 Nights / 12 Days
Istanbul(4N) → Cappadocia(2N) → Pamukalle(2N) → Dubai(3N)
₹ 110,800* per person
₹ 110,800*
Holiday in Dubai and Thailand Tour Package
Dubai(3N) → Krabi(3N) → Pattaya(3N)
Dubai and Oman Tour Package
Dubai(3N) → Muscat(3N)
₹ 49,000* per person
₹ 49,000*
Dubai Family Escape for 5 Nights: Tickets to Dubai Aquarium & Underwater Zoo
₹ 49,999* per person
₹ 49,999*
Dubai 7 Days Package - Couples Special
₹ 72,000* per person
₹ 72,000*
Exquisite Dubai & Abu Dhabi Getaway: Museum of the Future Included
Dubai(3N) → Abu Dhabi(3N)
₹ 70,000* per person
₹ 70,000*
Budget-friendly Dubai Tour Package & Dubai Shopping Festival
₹ 34,500* per person
₹ 34,500*
Exclusive 5 nights Dubai Tour Package (Candle light Dinner in Sanjeev Kapoor Restaurant)
₹ 32,900* per person
₹ 32,900*
Singapore Dubai Tour Package
Singapore(3N) → Dubai(3N)
₹ 71,000* per person
₹ 71,000*
Dubai Explorer's Retreat for 3 Nights
₹ 36,500* per person
₹ 36,500*
Dubai Mauritius Honeymoon Retreat Package
Mauritius(4N) → Dubai(2N)
₹ 58,000* per person
₹ 58,000*
Quick Honeymoon Getaway in Dubai with Desert Safari & River Cruise
₹ 25,500* per person
₹ 25,500*
Dubai Grand Discovery Package with Ras al Khaimah & Abu Dhabi Tour
Dubai(5N) → Ras Al Khaimah(0N) → Abu Dhabi(0N)
₹ 65,000* per person
₹ 65,000*
Cheapest Tour Package of Dubai with Desert Safari
₹ 29,425* per person
₹ 29,425*
Dubai Trio Package (City Tour, Cruise, Desert Safari)
₹ 32,400* per person
₹ 32,400*
Dubai and Abu Dhabi Tour Package for 5 Nights
₹ 48,000* per person
₹ 48,000*
4 Nights Dubai Package With Stay at Golden Sands Hotel Apartments
₹ 68,000* per person
₹ 68,000*
India and Dubai Tour Package
Delhi(2N) → Agra(1N) → Jaipur(2N) → Dubai(3N)
₹ 41,000* per person
₹ 41,000*
Emirates with Oasis of Arabia - 9 Nights Dubai Tour Package
Dubai(2N) → Fujairah(1N) → Al Ain(1N) → Abu Dhabi(1N) → Al Dhannah(1N) → Al Hofuf(1N) → Riyadh(2N)
Arabian Odyssey Dubai & Abu Dhabi Package with Al Ain Day Tour
Dubai(2N) → Abu Dhabi(2N) → Al Ain(0N)
₹ 36,450* per person
₹ 36,450*
Friends Trip to Dubai for 4 Nights
₹ 31,990* per person
₹ 31,990*
Delightful Dubai and Ras Al Khaimah Tour Package
Dubai(3N) → Ras Al Khaimah(1N)
Wonderful Dubai Honeymoon Tour Package
₹ 50,000* per person
₹ 50,000*
Special Dubai Tour Package & Abu Dhabi Day Tour
Dubai(4N) → Abu Dhabi(0N)
Dubai Package for 4 Nights 5 Days - Dhow Cruise Dinner
₹ 32,000* per person
₹ 32,000*
Dubai 5 Nights 6 Days Package with Ferrari World
₹ 84,800* per person
₹ 84,800*
Budget Dubai Friends Tour Package
₹ 30,500* per person
₹ 30,500*
Luxurious Dubai Tour Package for 4 Nights - Stay at Hyatt Regency Dubai
₹ 85,000* per person
₹ 85,000*
Exquisite Arabian Adventure - Dubai, Abu Dhabi & Doha
Dubai(3N) → Doha(3N)
₹ 60,500* per person
₹ 60,500*
Fun Family Dubai 4 Nights Package - Hot Air Balloon Ride
₹ 82,999* per person
₹ 82,999*
Mesmerising Dubai Tour including 1N Stay at Gevora (Tallest Hotel)
₹ 38,500* per person
₹ 38,500*
Exquisite Arabian Adventure - 6 Nights/7 Days
Luxurious dubai and abu dhabi tour - stay at yas viceroy and jw marriott.
Abu Dhabi(2N) → Dubai(3N)
₹ 93,000* per person
₹ 93,000*
Ultimate UAE Tour Package - Yas Island Adventure
7 Nights / 8 Days
Dubai(3N) → Ras Al Khaimah(1N) → Al Ain(1N) → Abu Dhabi(2N)
10 Days Dubai and Thailand Tour Package
10 Nights / 11 Days
Dubai(4N) → Bangkok(3N) → Phuket(3N)
Dubai Shopping Tour for 4 Nights - Luxury Yacht Dinner Cruise
₹ 42,500* per person
₹ 42,500*
Luxurious Dubai Package - Stay at JW Marriott
Best of uae tour package - 6 nights 7 days.
Dubai(4N) → Al Ain(1N) → Abu Dhabi(1N)
Latest Reviews for Dubai
Very prompt and accommodative.
Khushboo's Trip to Dubai
(Written on 09 Apr, 2024)
Anil's Trip to Dubai
(Written on 05 Feb, 2024)
Trip to Dubai
Sunil's Trip to Dubai
(Written on 31 Jan, 2024)
fantastic trip and well organised planing
YASHPAL's Trip to Dubai
(Written on 27 Jan, 2024)
Sohail's Trip to Dubai
(Written on 30 Dec, 2023)
Dubai vacation
Gada Dhar's Trip to Abu Dhabi, Dubai
(Written on 03 Nov, 2023)
Dubai Packages For Your Need
Dubai Honeymoon Packages
Starting from ₹ 12,822
India Dubai Tour Packages
Starting from ₹ 17,900
Dubai Turkey Tour Package
Starting from ₹ 82,000
Packages with Dubai
United Arab Emirates Packages
Other Packages You Might Like
Singapore Packages
Bangkok Packages
Phuket Packages
Krabi Packages
Pattaya Packages
Istanbul Packages
Tour packages for similar destinations
Sharjah Packages
Ras Al Khaimah Packages
Antalya Packages
Casablanca Packages
Miami Packages
Los Angeles Packages
Abu Dhabi Packages
Colombo Packages
Tel Aviv Packages
Honolulu Packages
Barcelona Packages
Tour packages for nearby destinations
Madinat Zayed Packages
Muscat Packages
Hanoi Packages
Top places for international vacation by months
- October to March
- April to September
FAQs on Dubai Tour Packages
How much is the burj khalifa ticket, which destinations are usually travelled together in dubai tour package, what are the best places to visit in dubai, is alcohol legal in dubai, how much does a dubai family tour cost, when is the cheapest time to travel to dubai, do indians need visa to go to dubai, how much does a dubai tour package cost, how much is a 5 day tour in dubai, which month is best to visit dubai, can you travel to abu dhabi with a dubai visa, how much does a 7-day trip to dubai cost, is dubai fun for couples, get the best offers on travel packages.
Compare package quotes from top travel agents
Compare upto 3 quotes for free
- India (+91)
*Final prices will be shared by our partner agents based on your requirements.
Log in to your account
Welcome to holidify.
Forget Password?
Share this page
Filter/Sort
Dubai Tour packages
If you're planning a trip to Dubai, Holidays Crowd is your go-to destination. Whatever your travel preferences may be, you'll discover the perfect Dubai holiday packages here. Whether you're in search of Dubai packages for a family or a couple, escorted Dubai tour packages for your parents, or an offbeat Dubai vacation for yourself, Holidays Crowd can assist you in organizing your Dubai trip plan.
Holidays Crowd currently presents a diverse selection of 62 tour packages to Dubai, featuring prices starting from as low as Rs.25733. Explore a range of itineraries and opt for Dubai travel packages with or without flights. Take advantage of our unbeatable deals and discounts to make your money go further. Don't overlook the option to enhance your selected Dubai packages with additional tours and activities.
Our Dubai packages are curated by theme as well, catering to various holiday preferences. Whether you're planning a honeymoon and seeking romantic Dubai packages for couples or desiring an adventurous Dubai trip with friends, Holidays Crowd offers the right choices. Whether it's a short getaway or an extended vacation, a laid-back stay or an active holiday, Holidays Crowd has the ideal Dubai vacation packages to suit your travel style. For those seeking a luxurious holiday, explore our luxury Dubai packages, providing the best hotels and inclusions for a pampering experience during your Dubai vacation.
To assist you in preparing for your Dubai travel, we've compiled useful tips, including the best time to visit Dubai and must-do activities in the city.
Explore India to Dubai Packages from cities such as Delhi, Mumbai, Bangalore, Hyderabad, Chennai, Ahmedabad, and Kolkata. Also, discover popular Dubai Theme Packages like Dubai honeymoon packages, Dubai adventure packages, Dubai tourism, and Dubai package.
Discover other popular Holiday Packages in India at Holidays Crowd, including Holidays Packages, Honeymoon Packages, India Cruise Packages, Beach Packages, Family Packages, Adventure Packages, Luxury Packages, Leisure Packages, Pilgrimage Packages, and Wildlife Packages.
Explore top International Holiday packages by Theme at Holidays Crowd, including International Tour Packages, International Honeymoon Packages, International Cruise Packages, International Beach Packages, International Family Packages, International Adventure Packages, International Luxury Packages, International Leisure Packages, International Pilgrimage Packages, and International Wildlife Packages.
Best Dubai Tour Packages in 2023
Dubai, the largest and most populous city in the UAE, stands as the realization of dreams and a favored destination for many globetrotters. A harmonious blend of ultramodern skyscrapers and captivating heritage, Dubai captivates the senses of travelers. Offering everything from luxury shopping to awe-inspiring desert landscapes, world-renowned restaurants and hotels to exhilarating theme parks, a trip to Dubai caters to every type of traveler, whether seeking a Dubai honeymoon package, a family vacation, or a quick getaway with friends.
Situated geographically in the Middle East on the south-east coast of the Persian Gulf, Dubai serves as the capital of the Emirate of Dubai, one of the seven making up the United Arab Emirates. As a major aviation and financial hub, Dubai has transformed into a global symbol of engineering and construction, prominently represented by the world's tallest building, the Burj Khalifa, gracing the city's skyline. Government-promoted Dubai tourism thrives on a mix of ancient and modern attractions, attracting tourists throughout the year.
Best Time to Visit Dubai
Dubai experiences a climate characterized by hot and hotter conditions with dry desert winds. For those planning a Dubai trip, it's advisable to avoid the dry and hotter months from April to September. The optimal time to visit Dubai is during the winter months, spanning November to March, when clear blue skies and delightful weather prevail. Winter months offer a sunny haven for sun-seekers and beach lovers, while shoppers can indulge in the Dubai Shopping Festival, typically held from December to February.
Expect some rainfall between January and March as part of Dubai's climate during these months. The summer months, from April to October, present an opportunity to escape crowds and secure budget-friendly hotel rooms. Dubai hotels are relatively affordable during the off-season, with comfortable indoor air-conditioning providing respite from the summer heat. For those in search of economical Dubai tour packages, Holidays crowd offers enticing deals during this off-season period for Dubai tourism.
How to Reach Dubai
The most convenient way to reach Dubai is by flight, with flights connecting the emirate to over 200 global destinations. Dubai International Airport, the largest in the UAE and among the busiest globally, is the primary entry point. Alternatively, travelers can fly to Sharjah International Airport and transfer to Dubai by road using taxi or bus services.
For travel within the Emirates, Emirates Express bus services connect cities like Dubai, Sharjah, and Abu Dhabi. Travelers from India can choose from multiple airlines, including Emirates, Air India, Air India Express, SpiceJet, Indigo, and Fly Dubai. Air Arabia operates flights from India to Sharjah. Direct flights from major Indian cities like Delhi, Mumbai, and Bangalore to Dubai are available, providing easy access for booking Dubai holiday packages on the Holidays crowd website. Explore the best of Dubai's tourist attractions and choose from a variety of Dubai trip packages, including exclusive Dubai honeymoon packages curated with the finest hotels and inclusions for a romantic getaway.
Places to visit in Dubai
Dubai stands as a radiant oasis amidst the desert, captivating travelers with its iconic skyline dominated by the Burj Khalifa. Whether approaching by road, witnessing the Burj Khalifa piercing the skyline, or by air, marveling at the glass buildings below, Dubai is a visual spectacle. The city's top attractions, including the Burj Khalifa, Burj Al Arab, Palm Islands, and World Islands, create a mesmerizing panorama.
To enhance your Dubai trip, here's our curated list of must-visit places:
Burj Khalifa
Commence your Dubai tour with the awe-inspiring Burj Khalifa, the world's tallest free-standing man-made structure at 828m. Visit during the day or wait for evening light shows. Ascend the world's fastest double-deck elevators to the Burj Khalifa Observation Deck on Level 124 or venture to Level 148 for a breathtaking cityscape overview. The observation deck, the highest outdoor one globally, is a highlight among Dubai attractions, attracting travelers of all preferences.
Adjacent to the Burj Khalifa, the Dubai Mall is a premier destination in Dubai and one of the largest shopping malls globally. Boasting over 1200 stores, it is the venue for the renowned Dubai Shopping Festival. Beyond shopping, visitors can enjoy diverse attractions, including an ice skating rink, cinema theatre, theme park, and aquarium.
Dubai Aquarium
Situated within the Dubai Mall, the Dubai Aquarium is a staple in Dubai city tours, particularly appealing to families. As the world's largest suspended aquarium, it houses 140 species, including rays and sharks. Traverse the 48m tunnel beneath the largest collection of sand tiger sharks globally. The mesmerizing view includes over 33,000 aquatic animals, making it an enchanting experience. The Underwater Zoo in the same mall features diverse ecosystems and creatures like Piranha, Penguin, Otters, African Crocodile, and Lionfish. This Dubai tourist spot offers attractions for every family member.
For an unforgettable Dubai experience, explore these attractions and more with Holidays Crowd. Discover Dubai's wonders through our thoughtfully curated Dubai tour packages. Whether it's the towering Burj Khalifa or the bustling Dubai Mall, our packages cater to diverse preferences, ensuring a memorable holiday for every traveler.
Ferrari World
Ferrari World Abu Dhabi, situated on Yas Island just a short drive from Dubai, is a prominent theme park that captivates many travelers on their Dubai holidays. An essential addition to your Dubai package with Holidays Crowd, Ferrari World boasts 37 rides and shows, including the Formula Rossa, the world's fastest roller coaster. With attractions like Adventureland and the Car Wash, there's something for everyone, making it a family-friendly destination.
Dubai Frame
Among the newest Dubai tourist places, the Dubai Frame, nestled within Zabeel Park, offers a unique perspective on Dubai's past, present, and future. Shaped like an ornate picture frame, it features an Old Dubai gallery with interactive displays, a panoramic Sky Deck showcasing present Dubai through augmented reality effects, and a Future Dubai gallery presenting a visionary image of Dubai. A visit to the Dubai Frame promises a one-of-a-kind experience.
Dubai Parks and Resorts
Dubai Parks and Resorts, the Middle East's largest integrated theme park and leisure destination, is an integral part of family-oriented Dubai packages. Comprising Motiongate Dubai, Bollywood Parks Dubai, Legoland, and Legoland Waterpark, it caters to diverse interests. Motiongate Dubai, a Hollywood-themed park; Bollywood Parks Dubai, the world's first Bollywood-themed park; Legoland with its Lego-themed attractions; and the Legoland Waterpark, designed for younger children, offer a range of entertainment. Pre-arrange a visit to any of these parks as part of your Holidays Crowd Dubai holiday package.
Atlantis the Palm - Aquaventure & Lost Chambers
While Atlantis the Palm is a sought-after luxury hotel in Dubai, it also offers attractions for those not staying at the hotel. The Atlantis Aquaventure Waterpark features over 30 thrilling slides, interconnected river rides, cownose ray feeding, and underwater adventures. Combine your Aquaventure trip with a visit to the Lost Chambers Aquarium, the UAE's largest aquarium, displaying over 65,000 marine animals. Enjoy exhibits, daily feeding shows, and the opportunity to dive or snorkel among the fish.
Dubai Fountain
Wrap up your evening at the Dubai Mall with the mesmerizing Dubai Fountain display, showcasing light and water jets reaching up to 150m in synchronized patterns. This water dance at the Dubai Fountain is an unforgettable experience, elevating the concept of a water fountain to the next level.
Enhance your Dubai holiday experience with Holidays Crowd by exploring these iconic attractions. From the thrills of Ferrari World to the enchanting Dubai Fountain, our thoughtfully curated Dubai tour packages cater to diverse preferences, ensuring an unforgettable vacation.
What to Eat in Dubai
Dubai offers a diverse culinary scene, ranging from international cafes and celebrity chef restaurants to family-friendly and Instagrammable locations. Explore some of the best food options in Dubai with Holidays Crowd:
Street Food: Indulge in non-vegetarian street food in Dubai's Bur Dubai or Deira areas. Try the traditional pizza, Manousheh, a delightful flatbread topped with Akkawi cheese, zaatar herbs, and olive oil. For spice lovers, Lahem Bl Ajin, Lebanese bread with spiced ground meat, is a must-try, often referred to as "Arabian pizza."
Traditional Specialties: Delight your taste buds with Chelo Kebab, a combination of kebabs served with saffron-scented basmati rice, or savor Shish Tawook, a traditional-style kebab sandwiched in bread. Al Machboos, a popular one-pot dish of rice and meat, and Al Harees, a special dish for weddings and festivals, are savory highlights.
Sweet Delights: Indulge in local sugary treats like Luqaimat, a deep-fried Ramadan dumpling, and Kanafeh, a traditional dessert with rose syrup and sweet cream cheese topped with pistachios.
Vegetarian Food: Apart from Indian cuisine, try local vegetarian specialties like Tabbouleh, a refreshing salad, and Fattoush, a salad with fried or toasted Pita bread. Most hotels in Holidays Crowd's Dubai packages accommodate vegetarian food upon request.
Indian Restaurants in Dubai: Explore a plethora of Indian restaurants, including Bombay Brasserie, Khyber, Indego by Vineet, Chutney’s, Gazebo, Mint Leaf, and Chor Bazaar.
Experiment with street food in Deira, explore beachside eateries at Kite Beach, or enjoy a lavish dinner at a rooftop restaurant in Dubai Marina. Dubai's multicultural population ensures a wide variety of flavors to satisfy every palate.
Fun Things to Do in Dubai
Beyond regular Dubai sightseeing, discover unique and enjoyable activities with Holidays Crowd:
Desert Safari with BBQ Dinner: Enhance your Dubai holiday package with an exhilarating Desert Safari. Venture into the golden dunes outside Dubai in a 4X4 vehicle for a thrilling off-road dune bashing session. Capture stunning sunset pictures and proceed to a desert camp for a delightful barbecue dinner and musical entertainment under the stars.
Ski Dubai: Visit Ski Dubai, the first indoor ski resort in the Middle East, located inside the Mall of the Emirates. Perfect for family fun, Ski Dubai offers skiing and snowboarding on various slopes for different skill levels. Enjoy activities like tobogganing, tubing, zorbing, wall climbing, bob sled rides, and explore the Snow Park's snow play zones. Don't miss the Penguin Colony, where children can meet King and Gentoo Snow Penguins.
Immerse yourself in these exciting experiences to make your Dubai trip with Holidays Crowd truly unforgettable.
Dhow Marina Cruise
Experience the charm of a Dhow Marina Cruise, a must-do activity in Dubai for first-time visitors. Navigate through the Dubai Marina, the world's largest man-made marina, on a traditional wooden boat known as a "Dhow." Admire the iconic skyscrapers lining the peaceful canal, including landmarks like the Dubai Marina Mall and the Burj Al Arab. Choose from different options such as a Dhow Cruise with Dinner, a Sunset Dhow Cruise, or a daytime cruise. Enjoy the serene boat ride accompanied by traditional music, gaining a unique perspective of the stunning architecture. Whichever Dhow Marina Cruise you choose, it promises a memorable experience during your Dubai trip with Holidays Crowd.
Dubai and shopping are synonymous, making it a key activity for all visitors. Explore upscale malls like the Dubai Mall, Mall of the Emirates, and Mercato Mall or indulge in bargain hunting at the Dubai Outlet Mall. For traditional shopping, visit Meena Bazaar in Bur Dubai, renowned for textiles, ceramics, handicrafts, spices, and souvenirs. If you're a dedicated shopper, plan your Dubai trip to coincide with the Dubai Shopping Festival for exceptional deals.
Party with a Scenic View
Elevate your evening in Dubai with a visit to Shimmers, a renowned beachside restaurant in Palm Jumeirah. Offering authentic Greek cuisine amidst enchanting views of the Burj Al Arab, Shimmers is an ideal choice for a special meal and a perfect addition to a Dubai honeymoon package. Alternatively, unwind at the Lounge at the Armani Hotel, indulging in aperitifs or nightcaps in a luxurious setting with an unforgettable view of the Dubai Fountain.
Jumeirah Beach Walk
Explore the upscale and pleasant Jumeirah Beach, with its popular open-air hangout, The Walk. Lined with fashion boutiques, retail stores, cafes, and restaurants, The Walk offers incredible views of the water, a pleasant sea breeze, and a buzzing atmosphere. Enjoy shopping for unique handicrafts and designer products while witnessing some of the world's best cars. The Walk is particularly vibrant at night.
For adrenaline enthusiasts, embark on a thrilling skydiving experience in Dubai. Feel the rush of freefall over the Palm Jumeirah landscape or the desert outside the city. Experienced instructors guide both beginners and experienced skydivers through tandem or solo jumps. The heavenly experience is worth every second. For a child-friendly introduction to skydiving, try iFly Dubai, featuring a 10m acrylic glass tunnel for an indoor skydiving simulation experience at Mirdif City Centre.
Elevate your Dubai holiday with these exhilarating activities curated by Holidays Crowd, ensuring an unforgettable and diverse experience in the city of wonders.
The 5 Most Instagram-Worthy Luxury Experiences in Dubai
Indulge in Dubai's opulent lifestyle with these top-of-the-line experiences that are perfect for capturing stunning Instagram moments. Elevate your Dubai trip with these unique activities suggested by Holidays Crowd:
1. Gyrocopter Ride: Take a breathtaking bird's-eye view of Dubai's glittering skyline and cityscape with a gyrocopter experience. This small private aircraft, similar to a helicopter, accommodates two people and operates from the Dubai Marina. Soar over iconic landmarks like the Dubai Marina, Palm Jumeirah, and the Burj Al Arab during a smooth 20-minute ride, capturing brilliant blue oceans and sparkling skyscrapers. An Instagram-worthy experience that will leave your followers in awe!
2. Stretch Limousine Ride: Feel on top of the world with a luxurious ride around Dubai in a stunning Stretch Limousine, complete with a private chauffeur. Enjoy an hour-long drive passing iconic landmarks such as the Burj Al Arab, Burj Khalifa, and the upscale Mall of the Emirates. Relax in plush leather seats, making this insta-worthy experience perfect for impressing someone special or planning a proposal during your Dubai trip.
3. Chopper Ride: Make your Dubai sightseeing extraordinary by adding a Helicopter Tour to your itinerary. Take off from the Jumeirah Heliport and fly past iconic sights like the Burj Khalifa and Dubai skyscrapers. Depending on the chosen flight duration, you'll witness additional landmarks like the Palm Jumeirah, Jumeirah coastline, Dubai Canal, Burj Al Arab, and more. A premium add-on to your luxury Dubai holiday, ensuring stunning Instagram-worthy shots.
4. Private Yacht Ride: Opt for a private yacht tour lasting 2 hours for a luxurious on-water experience. Accommodating a maximum of 6 persons, it's perfect for a family or a small group. Zip around in comfort, sip on refreshing drinks, and admire famous Dubai landmarks like the Atlantis Palm hotel and the Burj Al Arab from the water. Capture a different perspective of Dubai for your Instagram feed.
5. Full-Day Musandam Dibba Tour: Escape to Musandam in Oman, known as the "Norway of Arabia," just a two-hour drive from Dubai. Book a full-day tour to Musandam Dibba, offering a contrast to Dubai's modern urban landscape. Board a traditional Dhow for a cruise along the Arabian Sea's sparkling waters. Relax, enjoy the views, or partake in swimming and snorkeling in the crystal-clear waters. A highlight of your Dubai package, this experience is perfect for adding a touch of luxury to your Dubai honeymoon package.
Dubai offers endless possibilities, and a single trip might not be enough to explore all its wonders. With attractive Dubai ticket prices for flights from India, multiple Dubai holidays become a tempting option. This Dubai guide, provided by Holidays Crowd, aims to help you choose your favorite places to visit in Dubai for an unforgettable vacation. Explore Holidays Crowd's diverse range of Dubai packages from Delhi, Mumbai, and other major Indian airports to start planning your Dubai adventure!
Best attractions in Vietnam
Holiday destinations and packages., travel by themes, honeymoon tour packages, family tour packages, pilgrimage tour packages, friends tour packages, nature tour packages, mountains tour packages, beaches tour packages, solo tour packages, asian adventure, bali tour packages, thailand tour packages, vietnam tour packages, malaysia tour packages, maldives tour packages, sri lanka tour packages, singapore tour packages, nepal tour packages, bhutan tour packages, japan tour packages, seoul tour packages, hong kong tour packages, european vacation, paris tour packages, france tour packages, italy tour packages, spain tour packages, germany tour packages, amsterdam tour packages, finland tour packages, sweden tour packages, switzerland tour packages, greece tour packages, norway tour packages, scotland tour packages, ireland tour packages, london tour packages, russia tour packages, turkey tour packages, the american dream, new york tour packages, chicago tour packages, las vegas tour packages, los angeles tour packages, san francisco tour packages, washington tour packages, niagara falls tour packages, canada tour packages, middle east & africa, dubai tour packages, egypt tour packages, jordan tour packages, uae tour packages, oman tour packages, israel tour packages, south africa tour packages, cape town tour packages, kenya tour packages, cairo tour packages, tanzania tour packages, zimbabwe tour packages, the land down under, australia tour packages, new zealand tour packages, melbourne tour packages, sydney tour packages, © 2024 holidaycrowd private limited. all copyright reserved..
Women Travel Abroad
December 16-22, 2023.
Dubai, the ‘City of Gold’, is one of the most culturally diverse and over-the-top cities in the world. From record-breaking architecture and stunning coastlines to award-winning cuisine and exclusive attractions, it’s easy to see why this is the perfect place to experience a mix of cosmopolitan city with local culture. Join WTA to immerse yourself into the true Dubai experience: discover the city skyline by yacht, unleash your senses amidst the Old Souk spice market, and create unforgettable memories adventuring through the Arabian Desert. What are you waiting for?!
- Activity Level
DAY 1 – December 16 – Arrive at Dubai International Airport (DXB), and private transportation will bring you to your accommodations for the week. After settling in, get to know your fellow WTA travelers at the welcome dinner!
DAY 2 – December 17 – After a morning exploring the Jumeirah City Market, your group will embark on an unforgettable journey across the Dubai Desert on an Arabian Nights Desert tour. You will encounter the famously red sand dunes and experience the hospitality of a Bedouin desert camp. Here, you can partake in many interactive cultural activities including camel rides and belly dancing shows, and enjoy a memorable feast of local cuisines.
DAY 3 – December 18 – FREE Day. Enjoy a day of shopping, take a tour of the city, visit a museum, or take advantage of the gorgeous weather by relaxing and having a beach day.
DAY 4 – December 19 – Today, will enjoy Dubai’s skyline from the comfort of a private yacht. We will cruise and relax as we sail along the marina and Arabian Gulf waters. Glide by the Burj Al Arab, Atlantis – The Palm, and opt to swim in the marina lagoon.
DAY 5 – December 20 – FREE Day. Enjoy a day of shopping, take a tour of the city, visit a museum, or take advantage of the gorgeous weather by relaxing and having a beach day.
DAY 6 – December 21 – Get ready to be amazed on today’s Dubai City and Old Souk tour. Discover the landmarks of Dubai old and new. Tucked into Dubai’s Deira district just north of Dubai Creek, the Dubai Spice Souk offers some of the city’s most rewarding shopping. Here, covered alleyways brim with stalls that sell all manner of Arabian and Asian spices, herbs, and delicacies, making the souk ideal for souvenir hunters and anyone hoping to get a sense of old Dubai. After the tour, you will head to an Arabian Tea House for an authentic tea experience and some Emirati cuisine. Tonight, we will toast beachside to a wonderful week in paradise.
DAY 7 – December 22 – A private transfer will take you back to Dubai International Airport (DXB) for your connecting flight to the US.
PRICING: $4,850
WHAT’S INCLUDED:
- 7 days & 6 nights’ accommodations
- Single occupancy, luxury hotel
- Airport transfer
- Arabian Nights Desert Tour
- Private Souk Tour
- Private Yacht Tour
- FREE DAYS to explore
- Daily breakfast
- Daily group lunch (excluding FREE DAYS)
- Daily group dinner
- COVID antigen testing for USA re-entry, if applicable
WHAT’S NOT INCLUDED
- Roundtrip airfare from US to Dubai Airport (DXB)
- Travel insurance
- Items of personal nature
- Meals not listed above
- Optional excursions and tours not listed above
- Gratuities and tips for personal services
TRAVEL INSURANCE:
- Travel Guard
- Allianz Travel Insurance
ADDITIONAL INFORMATION:
- Traveler must make a NONREFUNDABLE deposit payment of $400 at time of registration to secure her spot.
- Monthly minimum payment of $400 is required on the first of every month until paid in full to keep your reservations current.
- Final payment must be made 90 days before the trip date.
- A 50% refund can be requested prior to 6 months before the trip start date found in your invoice.
- No refunds for cancellations within 6 months of the trip date found in your invoice.
- A $250 penalty will be charged for any outstanding balance after the final payment date found in your invoice.
- For inquiries, contact wtaadmin@ womentravelabroad.com
NEVER MISS A TRIP
Subscribe to our newsletter.
You have Successfully Subscribed!
I know you want to go but this trip is sold out. Click here to see our open trips. We would love to have you join us.
Activity Levels
If your vacation is your time to relax, and you're looking for a trip with minimal physical activity, then choose one of these packages. Explore via guided city tours and motor coaches, plus some light walking on flat ground, with plenty of time to unwind.
Recreational
These packages are a great fit if you seek a blend of light activities as well as leisure time. Throw on your favorite comfortable shoes and enjoy guided walking tours on easy terrain, as well as coach touring.
Not the sort to watch the world go by? These packages are perfect if you enjoy getting out in the world and being on-the-go! Enjoy longer walking tours and days full of fun activities punctuated with time to rest.
Want to see it all? If you enjoy exploring the world on foot, are in good physical condition, and don't mind some uneven terrain or steps, then these packages are for you! Enjoy exciting nature hikes, fast-paced city tours, and action-packed fun!
Search Flights X
- Dubai Tour Packages
Accommodation
Sightseeing
Packages available from
Rs. 24,140 - Rs. 89,990
Per Person on Twin Sharing
An OTP (valid for next 15 mins.) has been sent to you on your Mobile number
By clicking Submit, I agree to yatra.com Terms of use and Privacy Policy
A marketplace of suppliers
Real time, end to end customization
Stay in touch with our expert on live chat
Get the Best Holiday Planned by Experts!
- Enter Your Mobile Number
By submitting this form, you authorize Yatra.com and its partners to contact you for this enquiry.
- Get Free Quotes
Message Sent!
Thank you for submitting your holiday request. A Yatra representative will call you within the next 2 hours from 9990614615.
- By submitting this form I confirm that I am either over 18 years of age or possess legal authority to consent on behalf of the individual whose information has been provided above. I am willing to be contacted by Yatra and its third-party service providers for sale and promotion of travel related products and services. I allow Yatra to share my personal information like my name, email, phone number, destination city and date of travel with the third-party service providers. I understand that once my personal information is shared with the third-party service providers, Yatra would have no control over the same and these third parties may use my personal information for any subsequent marketing and sales communications for travel related products and services. Additionally, they may further share my information with their third parties.
- International Tour Packages
About Dubai Tour Packages
Best time to visit dubai, things to do in dubai, places to visit in dubai, how to reach dubai.
- All Packages (38)
- Customizable (38)
Marhaba Dubai - Land Only
- Seller : Yatra
Per Person on twin sharing
Best Of Dubai With Free 1 Hour Limousine Ride
- Seller : HOLIDAY HUT
Honeymoon In Dubai ( Land Only)
Simplified Dubai
- Seller : TravMall
Dubai Extravaganza ( Land Only)
Shimmery Dubai - Land Only
03 Night Budget Friendly Dubai
- Seller : Holidayers Travel Estate Pvt Ltd
One Of A Kind Dubai Tour Experience
- Seller : Holiday Season
Fachinating Dubai & Saudi
Dubai Fully Loaded With Abu Dhabi
Popular dubai tour packages, dubai tour packages faqs.
Q. Which is the best time to visit Dubai? A. Ahead of closing one of the Dubai packages, be sure you are booking in the right season. The winters, between November and March, are the best to visit Dubai as the temperatures are bearable and pleasant in the evenings, hovering between 17 and 30 degree Celsius. You can easily venture outdoors in this season, explore the city, its waterfront locations, beaches, and places of sightsee. A significant event in the Dubai-calender is the Dubai Design Week that kicks off in November. December brings in socialites and celebrities from all over the world as it is time for the Dubai International Film Festival. December is also rugby season in Dubai, with 16 international rugby teams competing with each other in an event of a massive scale. The New Years celebrations go on for the most of January with discounts being announced and shops loaded with an assortment of merchandise. The New Years celebrations are followed by the Dubai Shopping Festival, a mega event attended by around 2 million people from all over the world, taking advantage of the huge discounts on a range of products from gadgets to cosmetics. There are art shows and Jazz festival too that take place in this window, making it the busiest time of the year. Q. What makes Dubai’s Burj Khalifa so famous? A. There are ample Dubai tour packages and all of them comprise a trip to Burj Khalifa. The 160-storied Burj Khalifa at 2716 foot dominates Dubai’s skyline and is easily its most iconic feature. It is at the heart of Dubai and serves as a reference point to all other sites around it. Dubai’s most photographed monument, Burj Khalifa is the tallest building in the world and also the tallest free-standing building in the world, ostensibly making it the building to have the highest number of stories in the world. Its outdoor observation deck is the highest in the world and offers a breathtaking view of the entire Emirate. Its elevators travel the longest distance in the world. The building has multiple uses. It has some fine dining restaurants, a hotel - the Armani hotel, the only other one in the world after Milan, office space, residential apartments and most importantly the observation decks. The tower is surrounded by the massive Dubai fountains that are about as big as two football pitches. You can even sail on the Dubai fountain in the traditional abra boats. Q. Which is the best place to shop for gold in Dubai? A. As you book one of the Dubai holiday packages, you need to ensure that you have enough time for shopping on your hands. No avid shopper in Dubai leaves without shopping for some gold. The main reason for it being Dubai’s status as a tax-free region. In addition to that Dubai’s gold is known for its purity, price and designs, providing you authentic, certified gold. You can find an array of gold here, from gold gold, white gold, rose gold to green gold, with all the alloys of gold rendered into stunning designs. The best place to buy gold in Dubai is the Dubai Gold Souk housing more than 350 jewellery traders, each with their unique designs. Head to Gold and Diamond Park if apart from gold you are also interested in chic platinum, silver and gemstone jewellery. Joyalukkas is another famous gold jewellery brand, with their outlets spread across the whole of Dubai. Damiani and Atlas Jewellery are among the other places from where you can buy gold in Dubai. Q. What is the best time to book a Dubai tour package? A. The best time to book a Dubai tour package is between October to March because of the ideal weather for city tour, visit to theme parks, shopping in the markets of Old Dubai and other attractions. The annual Dubai Shopping Festival is held from December to January which lures tourists from across the globe. These months are also the peak tourist season in Dubai which means it could be expensive to travel but with the right tour package you can live your Dubai dream within your preferred budget. Dubai packages from Delhi start at Rs 35,000 including flights and stay. Q. What is the best mode of travel in Dubai? A. The cheapest way to travel in Dubai is the Dubai metro - one of the most advanced metro systems in the world. There are other public transport options such as taxis, buses, monorail or water taxis. Call Dubai taxi to book a ride or if you prefer app-based cab rides then go for Uber or Careem. You could also rent a car if you feel like driving around. Opt for hop-on hop-off bus if you want a city tour or go for regular buses. Buy a NoL Smart card for both bus and metro rides. Q. Do Indians need a visa for Dubai? A. Indian nationals need a visa for Dubai. It takes around 4-6 days to process a tourist visa. The cost for Dubai Visa ranges from Rs 6,500 to 7,500. According to the new Dubai Visa policy, Indian citizens can get visa on-arrival valid for 14 days if they hold a residence visa for UK or EU countries. All you need to do is to fill a form on arrival and pay an approximate sum of Rs 2,250. Q. How far is Burj Khalifa from Dubai Mall? A. The distance between Burj Khalifa from Dubai Mall is about 1 km and can be reached in 5 minutes. You don’t even need to step out of the mall to get to Burj. There is an access from the lower ground floor of the mall to reach Burj Khalifa. Q. Which is the cheapest mobile SIM card available in Dubai? A. Tourists can buy SIM cards at Dubai Airport; the major ones being the Du and Etisalat. Both the service providers offer similar prepaid plans at about same rates. Choose the data package according to your requirement but for tourist usage the best option is a combo pack with a good deal on both calling and data limit. Q. When is Dubai Shopping Festival held? A. The Dubai Shopping Festival or DSF is an annual retail extravaganza held between December to February upping the glam quotient of the city through pop-up shows, celebrity performances and fireworks. The month-long celebration organised by the Dubai tourism is among the best shopping festivals in the world. Enjoy heavy sale and discounts on some of the biggest global and local brands across 3,200 outlets in the city. Q. Can I consume alcohol in Dubai? A. The legal age for drinking in Dubai is 21 and tourists are served alcohol in hotels. Drinking alcohol in public is prohibited and could lead to hefty fine or imprisonment. Likewise passengers under the influence of alcohol in transit through the UAE can also be arrested. Tourists are allowed to buy alcohol from licensed venues such as hotels, restaurants and lounges. Q. Can I find Indian food in Dubai? A. There are 3 million Indians in the UAE which constitute as the largest non-indigenous community in the country. And Dubai being a favourite haunt of Indian tourists is dotted with several Indian restaurants serving cuisines from almost all regions of India. Some of the best Indian restaurants in Dubai are Rang Mahal, Jodhpur, Ashiana, Indego by Vineet, Calicut Paragon, Bombay Brasserie, Signature by Sanjeev Kapoor and Little Miss India. Q. Till when are the shopping malls in Dubai open? A. All the major malls in Dubai including Dubai Mall, Mall of the Emirates, City Centre Deira are open till midnight but the timings are extended till 2 am during Ramadan. A few food courts in selected malls remain open till 3 am during the holy month. Q. Is everything closed on Friday in Dubai? A. Banks, government and private offices are shut on Friday with a few exceptions as it is a weekly off. The malls, restaurants, shopping centres and other tourist hubs remain open on all days barring a few shops which close for an hour for the Friday prayer.
Popular World Tour Packages
- Places to visit
- Best time to visit
- How to reach
- Thing to do
- Sri Lanka Family Packages
- Europe Family Packages
- Switzerland Family Packages
- Mauritius Family Packages
- Dubai Family Packages
- Bali Family Packages
- Maldives Family Packages
- Singapore Family Packages
- Malaysia Family Packages
- Australia Family Packages
- Turkey Family Packages
- Greece Family Packages
- Spain Family Packages
- Vietnam Family Packages
- France Family Packages
- UK Family Packages
- Canada Family Packages
- Mexico Family Packages
- Florida Family Packages
- New Zealand Family Packages
- Places to vist in Bali
- Places to vist in Mauritius
- Places to vist in London
- Places to vist in Paris
- Places to vist in Dubai
- Places to vist in Maldives
- Places to vist in Bangkok
- Places to vist in Hong Kong
- Places to vist in Venice
- Places to vist in Sydney
- Places to vist in Cape Town
- Places to vist in Amsterdam
- Places to vist in Melbourne
- Places to vist in Colombo
- Places to vist in Mansarovar
- Places to vist in Kathmandu
- Best time to visit Maldives
- Best time to visit Singapore
- Best time to visit Bali
- Best time to visit Dubai
- Best time to visit Bangkok
- Best time to visit Kathmandu
- Best time to visit London
- Best time to visit Mexico
- Best time to visit Paris
- Best time to visit Mansarovar
- Best time to visit Toronto
- Best time to visit Hong Kong
- How to reach Maldives
- How to reach Dubai
- How to reach Bali
- How to reach Paris
- How to reach Kathmandu
- How to reach Mansarovar
- How to reach New York
- How to reach Colombo
- How to reach London
- How to reach Mexico
- How to reach Toronto
- How to reach Hong Kong
- Things to do in Bali
- Things to do in Maldives
- Things to do in Dubai
- Things to do in Mauritius
- Things to do in London
- Things to do in Paris
- Things to do in Kathmandu
- Things to do in Mansarovar
- Things to do in Venice
- Things to do in Sydney
- Things to do in Bangkok
- Things to do in Hong Kong
- Things to do in Cape Town
- Things to do in Amsterdam
- Things to do in Melbourne
- Things to do in Colombo
- Family Holidays
- Honeymoon Holidays
- Winter Holidays
- Summer Holidays
- Beach Holidays
- Hill Station Holidays
- Exotic Holidays
- Adventure Holidays
- Wildlife Holidays
- Affordable Holidays
- Luxury Holidays
- Cruise Holidays
Top International Flight Routes
- Delhi to Dubai Flights
- Mumbai to Dubai Flights
- Delhi to Toronto Flights
- Delhi to Singapore Flights
- Ahmedabad to Dubai Flights
- Delhi to Kathmandu Flights
- Bengaluru to Dubai Flights
- Mumbai to Bangkok Flights
- Mumbai to Toronto Flights
- Chennai to Colombo Flights
Looking for a Holiday Package?
Our Company
- More About Us
- Leadership Team
Our Products
- Customer Testimonials
- Press Releases
- Support & FAQs
- Terms & Conditions
- Privacy Policy
- User Agreement
- Retails Stores
- Visa Information
Top Travel Destinations
- Switzerland Tourism
- Bali Tourism
- Dubai Tourism
- Maldives Tourism
- Bhutan Tourism
- Vietnam Tourism
- Srilanka Tourism
- Thailand Tourism
- Singapore Tourism
- Malaysia Tourism
- Andaman Tourism
- Lakshadweep Tourism
- Goa Tourism
- Kerala Tourism
- Himachal Tourism
- Kashmir Tourism
- Gujarat Tourism
- Uttarakhand Tourism
- Meghalaya Tourism
- Leh Ladakh Tourism
Popular Honeymoon Packages
- Maldives Honeymoon Packages
- Bali Honeymoon Packages
- Singapore Honeymoon Packages
- Europe Honeymoon Packages
- Dubai Honeymoon Packages
- Malaysia Honeymoon Packages
- Thailand Honeymoon Packages
- Mauritius Honeymoon Packages
- Indonesia Honeymoon Packages
- Manali Honeymoon Packages
- Goa Honeymoon Packages
- Andaman Honeymoon Packages
- Ooty Honeymoon Packages
- Darjeeling Honeymoon Packages
- Kerala Honeymoon Packages
- Ladakh Honeymoon Packages
- Shimla Honeymoon Packages
- Munnar Honeymoon Packages
- Himachal Honeymoon Packages
- Kashmir Honeymoon Packages
- India Tour Packages
- Goa Tour Packages
- Manali Tour Packages
- Andaman Packages
- Ladakh Tour Packages
- Kerala Tour Packages
- Kashmir Tour Packages
- Rajasthan Tour Packages
- Ooty Tour Packages
- Uttarakhand Tour Packages
- Himachal Tour Packages
- Darjeeling Tour Packages
- Sikkim Tour Packages
- Jaipur Tour Packages
- Srinagar Tour Packages
- Munnar Tour Packages
- South India Tour Packages
- North India Tour Packages
- Kedarnath Tour Packages
- Lakshadweep Tour Packages
- Shimla Tour Packages
- Goa Packages from Delhi
- Goa Packages from Bangalore
- Gangtok Packages from Delhi
- Gangtok Packages from Kolkata
- Kalimpong Packages from Kolkata
- Maldives Tour Packages
- Bali Tour Packages
- Singapore Tour Packages
- Europe Tour Packages
- Greece Tour Packages
- Switzerland Tour Packages
- Malaysia Tour Packages
- Thailand Tour Packages
- Mauritius Tour Packages
- Bangkok Tour Packages
- Bhutan Tour Packages
- Nepal Tour Packages
- New Zealand Tour Packages
- Russia Tour Packages
- Turkey Tour Packages
- Egypt Tour Packages
- Canada Tour Packages
- Saudi Arabia Tour Packages
- Bahrain Tour Packages
Important Links
- World Tour Packages
- Honeymoon Packages
- International Honeymoon Packages
- Weekend Getaways
- Chardham Yatra
- Pilgrimage Packages
- Cordelia Cruise Packages
- India Tourism
- International Tourism
- Holiday Offers
- Port Blair Packages
- Chardham Packages
- Chardham Yatra by Helicopter
- Dalhousie Packages
- Dharamshala Packages
- Havelock Packages
- Gangtok Packages
- Kalimpong Packages
- North East Tour Packages
- International Flights
- Domestic Flights
- Domestic Airlines
- Cheap Flights
- Flight Schedule
- Flight Status
- Web Check In
- Hotels in India
- Hotels Near Me
- Bus Booking
- Cab Booking
- Outstation Cabs
- Indian Railways
- Distance Between
- Train Running Status
- Train PNR Status
- IRCTC Forgot Password
- Domestic Tour Packages
- State Wise Travel Guidelines
- Monuments of India
- Charter Flights
- Qutub Minar
- Visa at Your Doorstep
- Uk Visa At Your Doorstep
- Armed Forces Flight Booking
- Senior Citizen Flight Booking
- Student Quota Flight Booking
- No Cost EMI on Flight Tickets
- Terms & Conditions
- Special Events
- instagram twitter facebook rss youtube
Destinations
- Cook Islands
- New Zealand
- Papua New Guinea
- USA (Hawaii)
Go Your Way...Tailor-made
- Beach/Islands Escapes
- Classics (Bestsellers)
- Go As You Please
- Private Experiences
- Self-Drives
- Snowbird/Long Stays
- Stays of Distinction
- Stopovers/City Breaks
- Tailor-made Travel Ideas
- Vacation Packages with Air
Other Ways to Go
- Active & Adventurous
- Cruises & Sailing
- Escorted Coach Touring
- Holidays of a Lifetime
- 18 to 30 Somethings
- Rail Travel Ideas
- Small Group Touring
- Speciality Groups & Events
- Family Vacations
- Luxury & Beyond
- Romance & Honeymoons
- Singles Friendly
- South Africa
- More Countries
- China & Tibet
- Indonesia (Bali)
- Chile & Easter Island
- Ecuador & Galapagos
- United States
- Bucket List Travel Ideas
- Multi Country Vacation Ideas
- United Arab Emirates (Dubai)
- Australia & South Pacific
- Africa & Middle East
- Central & South America
- US & Canada
- Idyllic Islands
- UK & Europe
- Arctic & Antarctica
- Presidents Message
- About Goway Travel
- Special Services & Expertise
- Company History
- Goway's Early Days
- The World of Travel in 1970
- Goway Timeline
- Our Website
- Awards & Recognition
Our Services
- Why Travel with Goway
- Destination Knowledge
- Group Service
- Repeat Passenger Privileges
- Make it Extra Special
- Your Holiday Your Way
- Value Added Extras
- 50+ Reasons Why to Go Downunder with Goway
Our Policies
- Booking Conditions
- Commitment to Accessibility
- Consumer Protection Plans
- Our Guarantee
- Privacy Policy
- Travel Insurance
News & Media
- Globetrotting Blog
Globetrotting Magazine
- Press Release Centre
Online Presentations
- Travel Expos
- Different Jobs at Goway
- Train to be an Expert
- Current Openings
- Why Work at Goway
- Employment FAQ's
- Testimonials
- World's Idyllic Islands
- You are here
- › Africa & Middle East
- › United Arab Emirates
- › Dubai, United Arab Emirates
Dubai Vacations, Trips, Tours & Travel Packages
Dubai is located southeast of the Persian Gulf on the Arabian Peninsula and is one of the seven emirates that make up the United Arab Emirates. It houses the largest population in the UAE and is considered the most moderate and progressive of all the emirates to be experienced on a Dubai vacation.
Early archaeological findings in Dubai date back to around 8000 BC, however, the Sheikhdom of Dubai was not formally established until 1833. By the beginning of the 20th century, the area was an important trading hub and with the discovery of oil in 1966, infrastructure began to expand. Just a few years later, in 1971, Dubai became the second emirate to join the UAE.
Thanks to the revenues from the oil industry, a construction boom began in the 1980s, continued in the 1990s and the pace with which it accelerated during the new millennium was unrivaled anywhere else. As a result of this expansion, Dubai has grown into a cosmopolitan region famous around the world for its immense construction projects including Burj Khalifa, the world’s tallest building, skyscrapers, man-made islands and luxurious hotels, all to be wondered at on a Dubai vacation.
What are the top things to see in Dubai?
Sheikh zayed grand mosque.
A relatively modern Mosque constructed from 1996-2007, Sheikh Zayed Grand Mosque is the largest mosque in the United Arab Emirates’s capital of Abu Dhabi and a key place for worship during gatherings and prayers.
Burj Al Arab
Built on its own artificial island and connected by a bridge to the mainland. The Burj Al Arab’s designers wanted to create an iconic landmark for the city of Dubai and took inspiration from the shape of a ship’s sail.
Burj Khalifa
Known around the world for setting numerous height-related records, the Burj Khalifa was built based on gaining international recognition, investment, and improving tourism.
Dubai is considered one of the premier travel destinations in the Middle East . Shopping, whether in the world’s largest mall or traditional souks, is unparalleled. Dubai also offers stunning white beaches and endless water sports opportunities. A truly multicultural and global place, a visit to Dubai will not soon be forgotten.
United Arab Emirates Travel Information
At Goway we believe that a well-informed traveller is a safer traveller. With this in mind, we have compiled an easy-to-navigate travel information section dedicated to a Dubai vacation in the United Arab Emirates (UAE).
Learn about the history and culture of UAE, the must-try food and drink, and what to pack in your suitcase. Read about UAE's nature and wildlife , weather and geography, along with 'Country Quickfacts' compiled by our travel experts. Our globetrotting tips , as well as our visa and health information, will help ensure you're adequately prepared for a safe and enjoyable trip. The only way you could possibly learn more is by embarking on your journey and discovering UAE for yourself. Start exploring… book one of our United Arab Emirates tours today!
Extend Your Trip
After your Dubai tours, why not consider one of Goway's Europe Tours
Dubai, United Arab Emirates
23 trips available.
- Most Popular
Dubai Women’s Only Tour
UAE for Families
UAE Sky, Sand and Race Adventure
Best of the Emirates: Abu Dhabi & Dubai
Experience Dubai
Luxurious Maldives & Dubai
Signature Dubai and Mauritius
Signature Dubai & Phuket Escape
Dubai, Cairo & The Nile Escapade
Idyllic Dubai and Seychelles: Dubai, Mahe & Praslin
Ultimate Dubai & Saudi Arabia
Middle East Trio: Dubai, Abu Dhabi & Oman
Deluxe UAE & Maldives: Desert & Sea
Burj Al Arab, Dubai: Stays of Distinction
Dubai and Seychelles Escape
City Lights, Safari Sights with Dubai: Cape Town, Pilanesberg National Park & Dubai
Sultans to Safari
The Best of Dubai and Mauritius
Dubai & Mauritius Escape
Essence of Dubai
One and Only Royal Mirage Dubai: Stays of Distinction
Romantic UAE
Highlights of Dubai & Israel
- Trip Finder
What our travelers say
Goway toolkit.
Need help planning your holiday? Our toolkit is a great place to get started.
Airfare Only
Looking for an airfare only? Ask the airfare experts at GowayAir.
Customise Your Trip
Let us customize a dream holiday for you. Your trip your way!
Get a Trip Quote
Need help in planning your perfect holiday? A FREE travel quote!
Need a Visa?
Do you need a Visa to enter? Let us assist with your travel documents.
The magazine for world travellers. Get your FREE subscription today.
eNewsletter Sign Up
Stay up to date with the latest travel info and destination deals!
Order a Brochure
Planning your next trip? Our brochures are loaded with great ideas.
Enjoy our online presentations from the comfort of your home.
United Arab Emirates
- Beach & Island Escapes
- Luxury and Beyond
- Romance & Honeymoon
- Safaris Worldwide
- Single Friendly
- Vacation Packages with Airfare
Travel Information
- Introduction
- Things to do in the United Arab Emirates
- Country Quickfacts
- Food and Drink
- Geography and Maps
- Nature and Wildlife
- Travel Tips, Visas & Health
- UAE - Dubai
- UAE - Abu Dhabi
- Best Time to Visit the United Arab Emirates
- United Arab Emirates FAQs
- Destinations Offering Affordable Luxury for a Post-Pandemic Vacation
- Expo 2020 Dubai Is a Once-in-a-Lifetime Event
- Top Family Experiences in Dubai
- United Arab Emirates Destination & Travel Guide
- 10 Best Multi-Country Vacations
- 10 Cities That You Should Visit in Your Lifetime
- Group Travel for Women is On the Rise
- The 'What, Where, When and Why' of a Middle East Vacation
Featured Tours
- Highlights of Downunder
- African Safaris
- China Odyssey
- A World in One Country
- Classic Australia
- Classic Thailand
- Essential New Zealand
- Rio, Iguassu Falls, & Buenos Aires
- Essential Peru
BC Reg. #833-0; TICO Reg. #1543989; CST #2016613-20
- Accessibility
Web Design by Atomic Motion Built by Bright Interactive
GOWAY DESTINATIONS
You can unsubscribe at any time. Please see our Privacy Policy .
COUNTRYPICKERWESELECTEDHEADERMESSAGE
COUNTRYPICKERWESELECTEDMESSAGE click here
Cookies: We use cookies to improve your experience on this website. By continuing to browse our website, you are agreeing to use our site cookies. Please read more here
Choose your country and language
- The Americas
- The Middle East
- Asia & South Pacific
- Festive Offers
- Dubai Holidays
- Last Minute Escapes
- Holidays 2024
- Atlantis The Palm Offers
- Ras Al Khaimah Holidays
Middle East
- Ras Al Khaimah
Indian Ocean
- All-Inclusive Holidays
- Beach Holidays
- Business Class Holidays
- Family Holidays
- Luxury Holidays
- Winter Sun Holidays
- Additional Services
- In-Resort Service
- Opening Hours
- Pay My Balance
- 1 800 800 740
- Flight + Hotel
Search Holidays
- Manage My Booking
Dubai Holiday Offers
Dubai is home to a world of wonders for those adventurous to discover it. With something for every kind of traveller, Dubai is perfect for your next holiday. For those looking for a relaxing retreat, you will find some of the world’s best resorts, whether on the iconic Palm Jumeirah , bustling Downtown Dubai , the world-famous Jumeirah Beach or enjoying cafe culture along The Walk . Thrill-seekers will be in their element, with a plethora of high-octane theme parks and water parks, such as Dubai Parks and Resorts, Aquaventure Waterpark, IMG Worlds of Adventure, Wild Wadi Waterpark and so much more. It doesn’t stop there though; you could be racing down the slopes of Ski Dubai , reaching the dizzying heights of the world’s tallest building at the Burj Khalifa or soaring high above Dubai on a Seawings Seaplane Tour . Experience this and so much more on your next getaway. Find out more about a tantalising holiday in Dubai here .
Beyond that, Dubai is also home to the world’s largest shopping mall, The Dubai Mall , with more than 1,000 designer stores and boutiques where you’re guaranteed to find presents for all the family (or yourself). Aside from the largest mall in the world, Dubai also has a variety of bustling, traditional souks and shopping centres to cater for everyone’s shopping needs.
View our Dubai holiday offers below and book today to enjoy guaranteed savings, low deposits from €100, complimentary meal and room upgrades and many more extras to make your next Dubai holiday truly special. Book online or call us for more information on 1 800 800 740 .
- Three complimentary sessions at Atlantis Explorers Club and The Zone
Atlantis, The Palm, Dubai
- 5 nights from €2,349pp
- Ocean Room Queen
- Travel on selected dates from 24 to 30 October 2024
- Return Emirates flights from Dublin
- Price based on 2 adults and 2 children
Valid for new bookings only and subject to availability.
- Kids Eat and Stay Free
The Ritz-Carlton Dubai
- 5 nights from €1,839pp
- Half Board Dine Around
- Deluxe Room
Unlimited Access to Wild Wadi Waterpark
Jumeirah beach hotel, dubai.
- 5 nights from €2,169pp
- Deluxe Room Ocean with Balcony
- Unlimited access to Wild Wadi Waterpark
Supplements may apply for other departure airports. Valid for new bookings only and subject to availability.
- Complimentary Half Board upgrade
Anantara The Palm Dubai Resort
- 5 nights from €1,355pp
- Deluxe Lagoon View Room
- Travel on selected dates from 01 to 30 October 2024
- Access to Jungle Bay waterpark
The Westin Dubai Mina Seyahi Beach Resort & Marina
- 5 nights from €1,425pp
- Deluxe Skyline
- Kids Eat Free
Lapita, Dubai Parks and Resorts, Autograph Collection
- 5 nights from €1,055pp
- Half Board Plus
- Deluxe Twin Room Resort View with Park access
All-inclusive Dubai
Dubai Beach Holidays
Dubai City Breaks
Dubai Family Holidays
Explore Dubai
Join the emirates holidays community.
Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.
We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.
Why Emirates Holidays?
- Personalised holidays
- Support at every step
- Get more for your money
- Fly Better with Emirates
- Enjoy rewards with Emirates Skywards
For more information, please click here
- Recent Hotels 0 You do not have any recently viewed hotels.
- Shortlist 0 Your hotel shortlist is empty!
- Recent Searches You do not have any recent searches
Please refresh this page
This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.
- December 2024 Tours
Tours and Trip Packages to Dubai in December 2024
Traveling to Dubai in December 2024? We offer 55 tours, trips and vacation packages to Dubai in December 2024. Our Dubai in December 2024 tour packages and trips have 74 customer reviews. All the Dubai December 2024 tour packages and trips are carried out by hand-picked, qualified local and international Dubai tour operators.
- UAE Travel Guide
55 Trips in Dubai during December 2024
- Starts Dubai, UAE
- Ends Dubai, UAE
Best of Dubai Tour - 7 Days
- Free cancellation
- Trip customizable
- Tour Type Group Tour
- Activities Adventure & Desert safaris Adventure , Desert safaris , City sightseeing , Cruise , Cultural, religious and historic sites & Shopping and Markets 'data-more-tripid='41416'>+4 more
- Accommodation Hotel, Luxury Hotel & Resort
- Transport Private Vehicle & Yacht
- Age Range 1-79 yrs
- Operated in English
- View More Jan 1, 2019 Jan 2, 2019 Jan 3, 2019
Dubai Private Sightseeing Boat Tour
- Best price guaranteed
- Tour Type Private Tour
- Activities Sailing, yachting and motor boating
- Accommodation No Accommodation
- Age Range 2-79 yrs
Full Day Abu Dhabi Tour with Lunch
- Activities Cultural, religious and historic sites
- Age Range 5-79 yrs
Dubai Desert Dune Safari with BBQ Dinner
- Activities Adventure & Desert safaris Adventure , Desert safaris & Dune Bashing 'data-more-tripid='6539'>+1 more
Dubai Private Tour with Ticket to Burj Khalifa
- Activities Sightseeing Tours
- Operated in English, French, German, Italian, Spanish
Dubai Marina Dinner Cruise
- Activities Cruise
Scuba Diving Experience with BBQ Lunch
- Tour Type Small Group Tour
- Activities Scuba diving
- Operated in Arabic, English
Dubai By Night with Burj Khalifa tickets
- Age Range 1-99 yrs
- Operated in English, French, German
Dubai city tour with burj khalifa tickets
- Activities Sightseeing Tours & City sightseeing
Dubai Desert Safari incl. Dinner
- Activities Sightseeing Tours & Desert safaris Sightseeing Tours , Desert safaris & Dune Bashing 'data-more-tripid='968'>+1 more
75 Min - The Atlantis Sightseeing Boat Tour Dubai Marina
- Activities Sailing, yachting and motor boating & Sightseeing Tours
- Age Range 5-99 yrs
Snorkeling trip with BBQ lunch
- Activities Snorkeling
Best of Dubai Desert Safari Quad Bike & Dune Bashing
- Activities Adventure & Desert safaris Adventure , Desert safaris , Dune Bashing & 4x4, quad and ATV trips 'data-more-tripid='12425'>+2 more
Dubai Stopover - 4 days
- No booking fees
- Activities Explorer
- Accommodation Hotel
- Transport 4WD Jeep, Coach & Taxi
- Age Range 18-80 yrs
- Dec 01 Only 8 seats left
- Dec 03 Only 8 seats left
Traveling to UAE? Chat with a local travel specialist in UAE who can help organize your trip.
Dubai Tour Reviews
Popular activities.
- Explorer tours
Upcoming Departures
- Spring 2024/2025
- Summer 2024/2025
- Winter 2024/2025
- August 2024
- September 2024
- October 2024
- November 2024
- January 2025
- February 2025
- August 2025
- September 2025
Dubai Durations
- 1-day Dubai Tours
- 11-days Dubai Tours
Sign-in to unlock instant trip discounts. Create wish lists and save up to USD 1,500.
1800 22 7979
+91 22 2101 7979
+91 22 2101 6969
+91 88799 00414
Business hours
Top Recommended Destinations
Jammu and Kashmir
Sikkim Darjeeling
Himachal Pradesh
- Chandrataal
- Dharamshala
- Spiti Valley
- Nubra Valley
- Pangong Tso
Punjab & Haryana
- Kurukshetra
Uttarakhand
- Jim Corbett Park
Uttar Pradesh
- Fatehpur Sikri
Andaman & Nicobar Islands
- Neil Island
Andhra Pradesh
- Visakhapatnam (Vizag)
- Chitradurga
- Murudeshwar
- Shravanbelagola
- Athirappilly
- Thiruvananthapuram
- Kanchipuram
- Kanyakumari
- Mahabalipuram
- Pondicherry
Arunachal Pradesh
- Kaziranga National Park
- Manas National Park
- Cherrapunjee
- Bhubaneshwar
West Bengal
- Narmada Tent City
- Rann of Kutch
Madhya Pradesh
- Omkareshwar
Maharashtra
- Chittorgarh
- Kumbhalgarh
- Ranthambore
South East Asia
Australia New Zealand
Dubai Egypt Israel
- Nile Cruise
South Africa
- Johannesburg
- Pilanesberg National Park
- Port Elizabeth (Gqeberha)
- Stellenbosch
- Victoria Falls
- Rio De Janerio
- Los Angeles
- Niagara Falls
- Philadelphia
- San Francisco
- Nuwara Eliya
- Kuala Lumpur
- Genting Highlands
- Nusa Penida
- Ho Chi Minh
- Cherry Blossom Tours
South Korea
- Great Barrier Reef
- Great Ocean Road
New Zealand
- Christchurch
Western Europe
- Liechtenstein
- Netherlands
- Switzerland
- Vatican city
Central & Eastern Europe
- Czech Republic
Northern Europe
Mediterranean Europe
- Midnight Sun
- Northern Lights
- Scandinavia
United Arab Emirates
- Ferrari World
Saudi Arabia
An adventure of a lifetime awaits you. Immerse yourself in the untouched beauty of the last frontier on Earth, the serene beauty of icebergs, and witness landscapes that seem straight out of your dreams.
Speciality Tours
POPULAR & available TOURS
Honeymoon special.
Embark on a journey of togetherness.
Inspiring beautiful journeys & Scenic Routes.
Seniors' Special
Golden age celebration tours for 55+ yrs.
Women's Special
Exclusive handcrafted women only tours.
Family Tour Packages
Veena World’s safe, secure, and popular tours
Women's Special with Kids
Travel with your kids (boys & girls, under 12 yrs)
Upcoming Tours
Couples only.
Exclusive tours for middle aged couples.
Luxury Tours
Enjoy the sweet life of luxury & pampering.
One Week One Place
Explore one place at a relaxed pace.
Post Tour Holidays
Explore the city after your big tour.
Short Trips
Quick getaways to stunning destinations.
Treks & Hikes
Exiting adventure & challenges (15-55 yrs).
YOLO Adventures
Experiences for adrenaline junkies (18-35 yrs).
City Walks & Day Trips
Explore the city and culture.
WOW Adventures
Thrilling holidays for family (10-55 yrs).
Students' Special
Dhamaal tours after 10th & 12th exams
Customized Holidays
THEMED EXPERIENCES - Find your reason!
Romantic Holidays
City Breaks
Adventure Stories
Taj Holidays
Air Inclusive Holidays
Luxury Holidays
choose the right tailor-made luxury travel vacations
Island Getaways
explore the tropical island getaways
Buy & Sell Foreign Currency
Aed - uae dirham, gbp - british pound.
All your FOREX needs taken care of
Dubai Tour Packages
Straight out of the magical lamp, this Arabic land of future, lures every soul with its corny nature.
Dubai is a very futuristic city with innovations and developments cropping up on the basis of ideas, which are quite ahead of their time. This futuristic land which seems straight out of a magic lamp, is often seen as the first international trip option for many Indian travellers. Right from the entertaining Bollywood Parks to thrilling Desert Safari or even Burj Khalifa or the stunning Miracle Garden, this land will not fail to surprise you with what it has to offer along with our Dubai tour packages.
This energetic attraction is newly defining the trademark of an unrivalled identity in the world of Dubai travel! This land is a unique combination of beautiful manmade beauties, amazing amusement parks and some very unique and exotic experiences. Your trip to Dubai can be customised for you and your better half along with our Dubai honeymoon package. Veena World’s hand-stitched Dubai holiday packages are traced on these very lines to give you a chance to live your travel dream. We empower you to make the most fascinating memories with our Dubai holiday packages and invite you to relish our legacy to travel, explore and celebrate life.
Dubai Travel Packages
7 dubai holiday packages.
Highlights of Dubai Abu Dhabi
Tour includes, super deal price.
Best of Dubai Abu Dhabi
Senior's Special Dubai Abu Dhabi
Dubai Escape
Starts from.
Dubai Extravaganza
Dubai with Abu Dhabi
Dubai Atlantis The Royal
Dubai Honeymoon Packages
Bollywood Park Tour Packages
Dubai Family Tour Packages
Veena world tour reviews, what are you waiting for chalo bag bharo nikal pado, best of dubai abu dhabi upcoming tour dates.
"Overall the tour experience was excellent. This was my first tour with Veena world and I would definitely like to travel again with thi... Read more
"TOUR CODE MEMA070324/A There is no difficulty in bo... Read more
"Thank you Veena World for an Amazing tour of Dubai and... Read more
"Thank you for arranging this wonderful tour. The tour ... Read more
"We really had a great time in Dubai and Abu Dhabi thanks to arrangement made by Veena World and our Tour and Local Guide Mr. Nilesh Jos... Read more
Dubai Frequently Asked Questions
We help you prepare for your trip and ensure an effortless and enjoyable travel experience.
What can we do in Dubai in 5 days?
Dubai has a lot to offer and with the availability of various Dubai local tour packages online, exploring the city has become much easier. Surrounded by golden sands and marvellous structures, Dubai promises a mesmerising vacation for everyone. In 5 days, you can visit the world’s tallest tower – the Burj Khalifa, ride the Palm Monorail, visit the Atlantis, have a splendid time at the Bollywood parks, go for a desert safari, explore the city’s malls, and much more. We offer some amazing Dubai sightseeing packages that are tailored to give you an experience worth remembering.
What is the cheapest time to travel to Dubai?
If you are travelling to Dubai for a vacation on a limited budget, you can select Dubai city tour packages for the off-season, which falls from March to October. Though the weather will be hotter, you will still be able to enjoy the city at its best. You can visit festivals like Art Dubai, Festival of Taste, and so on and make your vacation even more amazing. During the off-season, the rates of Dubai sightseeing packages are quite low and you can get great deals and discounts on them. Click here to check out the group and family tour packages offered by Veena World.
Do Indians need a visa to travel to Dubai?
Yes, Indians do need a visa to travel to Dubai. You can choose the visa depending on the days of your stay in the city. The visa you need also depends on the type of entry. If you have selected a family package for Dubai, your visa will be for 30 days for multiple entries. If you are travelling solo, you can either choose a short term stay visa for 14 days or a 60-day stay visa. If you are selecting Dubai local tour packages, check out the terms and conditions while booking.
What is the best time to book a Dubai tour package?
Dubai city tour packages are always available. So, the time of booking depends on your trip planning. You can check out the itinerary and choose a package that suits you best. However, the peak season in Dubai is considered to be from November to February. You can visit events like the Motexha Textile show, Dubai Rugby Seven sport event, and enjoy a gala time exploring the jolliness in the city around New Year. You can book a Dubai family tour package at the best rates with us for any time.
How much does a Dubai trip cost?
Dubai is one of the most favoured destinations for everyone and the cost for your Dubai trip will depend on factors like how many people are travelling with you, for how many days you want to be there, visiting season (peak season or off-season), where you want to stay, and so on. However, you can select from the various Dubai family packages that are available online at Veena World for a hassle-free and convenient stay in the city. The cost of the trip will again depend on the type of package that you are selecting. Since the cost of a trip is always dynamic, you can check out the various packages offered by Veena World for more information.
Get to know more about Dubai before booking your tour packages
Dubai is a very futuristic city with innovations and developments cropping up on the basis of ideas which are quite ahead of their time. This futuristic land which seems straight out of a magic lamp, is often seen as the first international trip option for many Indian travellers. Right from the entertaining Bollywood Parks to thrilling Desert Safari or even Burj Khalifa or the stunning Miracle Gardens, this land will not fail to surprise you with what it has to offer along with our Dubai tours. At Veena World, connecting the core vivid nature of travellers to their dream destination is made possible with our tours dedicated to Dubai tour packages. For starry-eyed gazes, there are a lot of interesting places to explore and fun things to do for intimate and memorable escapes into the magical desert land of Dubai! The sheer excitement that arises with these unbelievable experiences lures in the calling that every explorer aims to achieve! Experience the land that appears to have come straight out of a magical lamp! The land full of man-made wonders which has left the world awe-struck with its mesmerizing arrays of creations. Your choice stands as our priority, may it be for adventure or for leisure, for one country special or two or even multi country, for some special reason like honeymoon or just a short escape travel, for a desire to travel alone or with family and all of it is made possible with Veena World!
Veena World has a focus of innovating and building unrivalled Dubai holiday packages from India tours, available online at affordable price and full of unforgettable experiences. We bring together everything best available, for a one of a kind memory and travel story that can be shared with your loved ones. Travelling with any of our uniquely priced Dubai travel packages available online, just once wouldn’t be enough! Raise your spirits for the most awaited Middle East sojourn along with our Dubai tour packages.
The Geography and Seasons
Dubai city, a prominent emirate among the 7 emirates of the United Arab Emirates is known for luxury shopping, ultramodern architecture and a lively nightlife. Located on the Persian Gulf, it shares a border with Abu Dhabi, Sharjah and Oman. Dubai theoretically only experiences two seasons, hot and hotter! The most pleasant period to visit and travel around UAE is during winter season which runs from October to March when the weather is moderate and pleasant, making it ideal to go for sightseeing tours or indulge in outdoor activities. The spring and autumn months are also great times to visit United Arab Emirates along with our Dubai holiday packages. Experience this warm seasonal charm of the Arabic lands along with our Dubai travel packages from India.
The Culture
Dubai is the Arabic land, straight out of the magic lamp! With the desert culture and the modernised architectural growth, Dubai continues to surprise the world; an experience which can be seen in our Dubai travel packages. Explore this marvellous emirate along with our Dubai tour packages. The increasing globalisation and the settling of various immigrant groups have transformed the city into a melting pot of different nationalities giving rise to a cosmopolitan culture living in a harmonious land of future. Explore this unique futuristic land straight out of the fiction along with our Dubai holiday packages.
The Experience
Explore the amazing city of Dubai along with our affordably priced Dubai tour packages from India which includes a photo stop at Burj Al Arab popularly known as the tallest hotel in the world, take a walk around the Jumeirah Beach and drive through the famous Sheikh Zayed Road which connects seven emirates of Middle East i.e. Abu Dhabi, Dubai, Sharjah, Ajman, Umm Al Qaiwain, Ras Al Khaimah and Fujairah by road. You also get the opportunity to take a ride in the Palm Monorail. Later, visit the Dubai Museum which is the oldest existing building in Dubai. Witness Atlantis Hotel, known to be the first resort built on the artificial island of ‘The Palm’. Enjoy a thrilling ‘Desert Safari’ by Land Cruiser through the sand dunes followed by an amazing belly dance show along with dinner. Explore Miracle Gardens along with a chance to shop in one of the biggest shopping malls in Dubai, Dubai Mall which has some famous brands such as Mark and Spencer, Waitrose, Bloomingdale's and many more. Your trip to Dubai can be customised for you and your better half along with our Dubai honeymoon package. Enjoy shopping at Deira City Centre which is one of the six city centres of Dubai. Truly experience, what makes shopping a therapy along with our Dubai shopping festival packages available online!
The Highlights
When you are in Dubai, embark on the Dhow Dinner Cruise to enjoy the amazing view of Dubai skyline while we indulge in some delicious Arabic Cuisine. Your trip to Dubai can be customised for you and your better half along with our Dubai honeymoon packages from India available online. Then visit Dubai Mall’s Aquarium which is home to more than 33,000 living animals, including 400 sharks and rays and experience a close encounter with the marine animals via its acrylic walk-through tunnel along with our Dubai holiday packages. Also visit Underwater Zoo and the tallest building in the world, Burj Khalifa at the Top, from where you get an amazing view of this city from the tower’s 124th Floor. Enjoy the amazing fountain show at Dubai Mall along with our Dubai tour packages. Later, experience Bollywood theme park Dubai known as the first theme park in the world dedicated to all things Bollywood! Your trip to Dubai can be customised for you and your better half along with our Dubai honeymoon package. Get a chance to visit Global Village during Dubai shopping festival. Enjoy one way Water Taxi ride to the Gold Souk. Later in your free time, indulge yourself in shopping at the Gold Souk which is a traditional identity of gold market of Dubai along with our Dubai shopping festival tour packages! Enjoy shopping at Deira City Centre which is one of the six city centres of Dubai. Truly experience, what makes shopping a therapy along with our Dubai shopping festival packages available online. All of such experiences added along with Dubai travel packages from India, is nothing but a cherry on top the cake!
APRIL SALE: Discover and book at up to 60% off!
United Arab Emirates Tours in December 2024
- Apr '24
- May '24
- Jun '24
- Jul '24
- Aug '24
- Sep '24
- Oct '24
- Nov '24
- Dec '24
- Jan '25
- Feb '25
- Mar '25
85 United Arab Emirates trips in December 2024
Magical Dubai
The trip was enjoyable, Kuwait airline carrier was the worst in service. We enjoyed the trip and the sights taken to. Our guide Rafig Faisal was excellent and very informative and insured we were well taken care of. The bus driver was polite and helpful.
- In-depth Cultural
- Christmas & New Year
DUBAI – Skyscrapers Desert Abu Dhabi with Oman Highlights
Best of Dubai Tour- 6 Nights and 7 days (4 star Luxury Apartment Hotel)
I did 7 days Dubai Tour With Relax Getaways this July. Trip was so well managed and hassle free. Pick up services was very punctual and informations shared was exact and informative. The itineraries and included activities is awesome. All the popular activities are included and you can add more activities of your interest in free day. Services from RG is above the mark and very responsive. I recommend to take Relax Getaways to plan your holidays.
- Book With Flexibility This operator allows you to rebook your dates or tours with them for free, waiving change fees.
- Sightseeing
Explore Dubai & Abu Dhabi 4 Nights 5 Days
It was mostly a private tour since we were 6 in this trip, and sometime we were combined with others on a big bus just like any big tours. Over all it was a great experienced although it missed some schedules, but they were able to compensate us and fixed it. I highly recommend this company! I enjoyed the Safari experienced and Abu Dhabi mosque visit. The price is also reasonable.
The UAE Essentials - Escorted Tour in 4 Stars Hotels – Full Board Plan
One of the precious travel memory in the travel life. Burj-Khalifa is really a wonder to the world. Desert safari could be more energetic. I also took a picture with the falcon on my shoulder. My brother recommended this package and guys I loved it.Good service, delicious food and good value of money.
Dubai Luxury Holidays Package 6 Night 7 Days
Great tour! Well organised and stress free! I would really recommend JTR Holidays! Thank you!!
The UAE Complete - Escorted Tour in 4* Hotels – Full Board Plan
Tour bus audio system wasn't working properly so couldn't hear what tour guide was talking about.
Dubai Escape
It was a great experience. Everything was organized nicely.
09-Day Dubai Family Explorer tour
Best of Dubai Tour - 7 Days Luxury Tour
My partner and I recently had the pleasure of booking the "Best of Dubai Tour" with Luxury Holidays Nepal, and it was an incredible experience from start to finish. This 7-day package allowed us to explore the magnificent city of Dubai and its iconic landmarks, all while enjoying top-notch service and seamless organization. From the moment we landed at Dubai International Airport, we were warmly greeted by the company's representative who guided us through a smooth check-in process and provided us with all the necessary information for our trip. The pre-trip meeting was informative, and we felt well-prepared for the adventures that awaited us. Our second day kicked off with a guided Dubai city tour, where we got to witness the city's impressive architecture, vibrant culture, and rich history. The highlight of the day was undoubtedly the visit to the Dubai Frame, which offered breathtaking panoramic views of the city. The guide was knowledgeable, friendly, and ensured that we didn't miss any of the city's must-see attractions. On day three, we embarked on an adventure-filled day exploring Dubai Mall, the Burj Khalifa, Dubai Aquarium, and the Underwater Zoo. It was a surreal experience to witness the grandeur of the world's tallest building and get up close and personal with marine life at the aquarium. The company's attention to detail and seamless coordination made this day truly unforgettable. The fourth day was dedicated to the exhilarating Desert Safari, and it exceeded our expectations. Luxury Holidays Nepal provided a comfortable and well-maintained vehicle for the journey, and the dune bashing experience was an absolute thrill. The evening continued with a delightful BBQ dinner under the stars, accompanied by traditional performances that added to the magical ambiance. Our visit to the Dubai Miracle Garden on day five was a feast for the senses. The colorful floral displays were a visual spectacle, and we enjoyed strolling through the beautifully landscaped gardens. The Dhow Cruise Dinner in the evening provided a romantic and enchanting experience, complete with delicious food, live entertainment, and stunning views of the city skyline. Day six was our free and exploration day, allowing us to personalize our experience and visit any attractions we had missed or wished to revisit. The company provided helpful suggestions and recommendations, ensuring we made the most of our time in Dubai. On the final day, Luxury Holidays Nepal facilitated a seamless departure process, arranging for our airport transfer and ensuring our journey back home was as comfortable as possible. Overall, we cannot speak highly enough of our experience with Luxury Holidays Nepal and their "Best of Dubai Tour." The itinerary was well-designed, allowing us to experience the diverse facets of Dubai, from its modern wonders to its cultural heritage. The guides were knowledgeable, professional, and went the extra mile to make our trip memorable. If you're planning a trip to Dubai and want a hassle-free and unforgettable experience, we wholeheartedly recommend booking with Luxury Holidays Nepal. They exceeded our expectations in every aspect, and we look forward to exploring more destinations with them in the future. Thank you, Luxury Holidays Nepal, for an incredible journey that will remain etched in our memories forever!
Customized Private Dubai & Abu Dhabi Vacation with Daily Departure
Stars of Dubai - 6 days
All of the tour guides were excellent and very knowledgeable. My only issues were that we paid for a 5 star hotel and we got a 4 star hotel. I let a representative know about this hotel discrepancy and nothing was done or corrected. It was never addressed. Also, we were not informed that we would not be seeing certain listed sites until I asked why we didn't see them. I was then told they were closed due to Covid. Those sites are still listed in the online brochure and thus included in the price.
Best Dubai tour with 4 star luxury Hotel Accommodation
Dubai & Abu Dhabi
Dubai & Emirates - 8 days
Very good services for the whole package..love the hotel and the itinenery.thumbs up for all d english speaking guide
What people love about United Arab Emirates Tours in December
Sehr viel gesehen, sehr gute Organisation, gutes Essen, ausgezeichneter Reiseleiter, insgesamt sehr zufriedenstellend. Allerdings: Beworben wurde die Reise mit einer maximalen Gruppengröße von 20 (!), was ein wesentliches Motiv für die Buchung war. Tatsächlich war die Gruppengröße 39 - 41, also doppelt so groß!!!! Wie vertrauenswürdig sind eigentlich die Angaben zur Reise? Wäre die Gruppengröße mit max 40 Personen angegeben gewesen hätten wir diese Reise NICHT GEBUCHT!
Loved the whole trip! All staff were very nice and accommodating, would definitely recommend
- Spring 2024 tours (96)
- Summer 2024 tours (94)
- Fall / Autumn 2024 tours (94)
- Winter 2024 / 2025 tours (89)
- Spring 2025 tours (55)
- Summer 2025 tours (39)
- Fall / Autumn 2025 tours (37)
- Winter 2025 / 2026 tours (21)
0877 40 50 00
Dubai Holiday Deals
Deals for everyone.
Explore holidays by interest
Adults Only
Adventure & Active
All Inclusive
Attractions
Culture & History
Family & Kids
Food & Wine
Local Holidays
Nature & Wildlife
Relax & Recharge
Romantic & Honeymoon
Sports & Events
Sustainable & Eco
Winter & Ski
Top destinations
Popular local & international holiday deals
Mauritius & More Island holiday deals
South Africa Local holiday deals
International holiday deals
Popular holiday destinations
South Africa holiday deals
Mauritius holiday deals
United Arab Emirates holiday deals
Thailand holiday deals
France holiday deals
United States of America holiday deals
Italy holiday deals
UK and Northern Ireland holiday deals
Maldives holiday deals
Greece holiday deals
Spain holiday deals
Seychelles holiday deals
Singapore holiday deals
Indonesia holiday deals
Netherlands holiday deals
Germany holiday deals
Portugal holiday deals
Australia holiday deals
Ireland holiday deals
Mexico holiday deals
Canada holiday deals
Malaysia holiday deals
New Zealand holiday deals
Vietnam holiday deals
Zanzibar holiday deals
More about Dubai Deals
Create your own trip, site quick links, help & support.
© Flight Centre Travel Group (Pty) Ltd. Registration No. 1994/000253/07.
*Prices are in ZAR and subject to availability. Please refer to specific product’s terms and conditions.
You are using an outdated browser. Please upgrade your browser to improve your experience.
We use cookies to improve your website experience and provide more personalized services to you, both on this website and through other media. By continuing to use this website, you agree to our use of cookies as explained in our Cookie Policy . Please read our Cookie Policy for more information on how we use cookies and how you can disable them.
New User? Register
- Manage bookings
- Cancellation
- On Behalf Booking
We're unable to sign you in because the password entered incorrect.
Your request for OTP will be sent to registered email id and mobile number, if not registered please do the same.
You exceed the OTP limit. Please try again after some time
Don't have an account?
- Contains between 8-12 alphanumeric characters.
- Can add special character but not mandatory(Only !, @, #,$,%,^,&,* to be used).
- Does not contain White spaces
I would like to be kept informed of special Promotions and offers. I hereby accept the Privacy Policy and authorize Thomascook to contact me.
Already have an account?
- Your existing Google or Facebook Id will be a Thomascook ID
- No need to remember different Ids & Passwords
- One Click login
Fill in the email Address that you used to register or book with Thomascook.
We will reset and send your new password.
Please enter the valid email address
Thomascook Staff / Preferred Agents / corporate's, please enter your Login-id only. E.g. Tcil_aalok / Jaft_prakash / Rc_mumbai
Your request for new password has been accepted.
The new password would be emailed to the registered email address, if not registered please do the same
The page you searched is temporarily unavailable
Kindly use the links below..
- international tour packages
- dubai tour packages
Oops! We could not find any result for the given search.
Sorry, the fields marked in red need your attention, please fix them to continue.
Dubai Tour Packages - Buy 1 Get 1 Free
Holiday tour packages (trending).
International Tour Packages
India & Around Tour Packages
I accept Privacy Policy and I authorise Thomas Cook Group Companies to contact me.
International Tour Packages (Trending Destinations)
Europe Tour Packages
Stroll through the beaches and explore the wild in the cultural island with your better half. Maldives is an all-in-one experience.
USA Tour Packages
Visit USA - the third largest continent in the world. Packed to the brim with personality, charm, diversity and great natural beauty.
Australia Tour Packages
A trip to Australia is a must if you crave for a blend of adventure, scuba diving, colorful mountains, rich wild life and much more.
New Zealand Tour Packages
Unending vistas of breath-taking landscapes await you at New Zealand – Fall in love with huge mountains, clear waters, adventure, wildlife & more.
Asia Tour Packages
The land of hidden gems, unexplored grasslands, temple towns, bustling streets and golden beaches; this is Asia for you.
Mauritius Tour Packages
They say that Mauritius was fashioned out of the handbook of the Gods. For the most part, it’s true.
Singapore Tour Packages
Bling and sparkles everywhere with tall buildings, scrumptious food, and lightning speed transport - Singapore deserves a spot on your ultimate holiday bucket list.
India Tour Packages & Around
Andaman Tour Packages
The Andamans - A wonderland of teal and turquoise. Where the seafood is more flavourful, and the fruits are juicier.
Kerala Tour Packages
Welcome to God's own country. Kerala is where tranquil backwaters, manicured tea estates, enchanting forests, beguiling mountains await you.
Himachal Tour Packages
The land of Gods awaits your visit. Choose to relax & enjoy its stunning beauty with the love of your life or wish to heed your spiritual call & discover yourself.
Rajasthan Tour Packages
Rajasthan synonym Royal, Regal, Revered. A magical universe of colour coded kingdoms. A place where little red turbans and green saris dance to classical music.
Kashmir Tour Packages
Experience Heaven on Earth. Beautiful verdant mountains and valleys, religious shrines, temples, wildlife, art and culture, festivals and much more.
Sri Lanka Tour Packages
A teardrop, found sliding along the Indian Ocean, is the magical land of Sri Lanka. It's is a magical, beautiful and diverse nation.
Bhutan Tour Packages
Bhutan is a jumble of impressions. A melange of sight, sound and taste. And its a one of a kind place where happiness is measured.
Truly a global city of the future, Dubai is less of a city and more of an experience. And the experience that is Dubai, is best explored with Thomas Cook India's Dubai tour packages . They offer you a wide range of choices to plan the perfect Dubai trip and get your fill of the best it has to offer. A memorable experience is guaranteed regardless of which Dubai tour package by Thomas Cook India you choose. Thomas Cook provides Buy 1 Get 1 offer on Dubai tour packages starting at just Rs. 21 137.
Table of Content
- Popular Dubai Tour Packages 2024
Plan your Dubai Tour with Thomas Cook
- Best time to visit Dubai
Honeymoon in Dubai
- How to reach Dubai
- Best Places to Visit in Dubai
Foods to Eat in Dubai
Best restaurants in dubai.
- Things to do in Dubai
Dubai Shopping Festival 2023-24
Shopping in dubai, adventurous things to do in dubai, best places to stay in dubai, people also ask about dubai tour packages, most popular dubai tour packages 2024.
Why Choose Dubai Tour Packages from Us
Every Dubai holiday package is a curated collection of experiences put together by the travel experts at Thomas Cook India, who are themselves, seasoned travellers, having taken a Dubai holiday many times. This means that no one else can take you on a Dubai tour like Thomas Cook India can. Furthermore, Thomas Cook India understands that no two Dubai packages are alike and everyone has different expectations from a Dubai tour package. You, therefore, have the freedom to customize a Dubai holiday that checks all your boxes of things to do in Dubai. In keeping with social distancing norms, you can even book Thomas Cook India's Dubai trip packages online.
Wherever you live in India, Dubai beckons as it enjoys direct connectivity with all the major cities of India like Mumbai, Delhi, Kolkata, Chennai, Bengaluru and Hyderabad. So, pack your bags and get ready for the ultimate desert vacation. Read on to find out more about your dream Dubai vacation.
The Best Time to Visit Dubai
Winter, from November to April, is the best time to book your Dubai package with Thomas Cook India. Dubai has two main seasons, summer and winter. Between May and October, the summer season takes over Dubai and the temperatures average between 24°C and 43°C. On the other hand, the winter temperatures are relatively pleasant and range between 19°C to 32°C, making it the ideal season for a Dubai holiday. Winter is also the season when Dubai receives most of its rainfall. These showers will make your Dubai tour a pleasant experience without hampering your Dubai sightseeing.
The temperate winter allows you to explore Dubai’s beaches and indulge in outdoor activities such as picnics, desert safaris and dune bashing during your Dubai vacation. The days see warm sunshine and bright blue skies while the evenings are fanned by the gentle desert winds. If you’re a shopaholic looking for amazing deals during your Dubai holiday, January and February are your months to visit Dubai. The Dubai Shopping Festival starts in January and continues into February and offers incredible deals, as much as a 75% discount, on electronics, jewellery, fashion and more.
Dubai is the perfect honeymoon destination for couples looking to honeymoon in fast-paced cosmopolitan cities with tons of excitement around every corner. When you book a Dubai tour package don't forget to check out our offers for your dubai honeymoon, you book a trip to an exotic paradise that fuses its native Arabian traditions with all of the luxuries of the West. Dubai is a cultural melting pot where you can rub shoulders with people from all over the globe, not to mention enjoy a diverse medley of cuisines. Then, of course, there is the rugged beauty of the desert and the adventures you can experience during your Dubai tour, whether you plan on enjoying a day at the races or taking a desert safari to watch the exotic shimmy of a belly dancer. Thomas Cook India gives offer on Dubai trip packages to guarantee your honeymoon lasts longer than the time you actually spend in Dubai thanks to all the memories you will create together.
During your romantic Dubai holiday, there are plenty of fun-filled activities to squeeze into your Dubai tour package ranging from shopping at the massive Dubai Mall to sailing along the Dubai Creek in a dhow whilst enjoying a romantic dinner and soaring up to the observation deck at the Burj Khalifa to add a spark of adventure to your marriage.
How to Reach Dubai
The Dubai International Airport is a world-class terminal and the busiest one in all of UAE. It is well connected to almost all the major Indian cities such as Mumbai, Delhi, Chennai, Bengaluru, Kolkata and Hyderabad making it an easy task to reach Dubai . You can easily get regular direct or connecting flights into Dubai from any of these cities. Some of the well-known airlines that operate flights to Dubai include Emirates, Etihad, FlyDubai, Air India, SpiceJet and IndiGo. Dubai’s airport sits 5 kms outside the city but is well connected with public transport.
If you cannot find a flight to Dubai, the next best option is to fly into Sharjah, which is Dubai’s closest neighbour. You will need a visa before you land in Dubai. Getting a UAE visa is easy, and you can get yours in 4-5 working days. However, if you hold a valid US, UK or Schengen visa, you do not need a separate visa for Dubai. All you must do is fill up a form after landing.
Local Transport Within Dubai
The public transportation system in Dubai - metro, buses, trams, abras, ferry, and water taxi - are managed by the RTA. The best part is that all these services use the same ticket type - the NOL card. You don't need to worry about purchasing a different ticket for each service. You could alternatively rent a car to drive yourself around provided you possess the prerequisite driver’s license.
Places to Visit in Dubai
Starting out as a tiny fishing village, the emirate of Dubai has become the pearl of the Middle East. Your Dubai holiday is set against the backdrop of one of the most sought-after holiday destinations in the world. Therefore, your list of places to visit in Dubai must be suitably updated to reflect the best of its larger-than-life, world-class entertainment, its parks and resorts, its grand malls.
Here are the best places to visit in Dubai:
The Burj Khalifa - Tallest Building in Dubai
Dubai mall - biggest mall in dubai, madinat jumeirah, the dubai fountain - magical medley of lights, water & sound, mall of emirates - luxury shopping destination in dubai.
- Dubai Aquarium – Unique Underwater Zoo
Beaches in Dubai
Jbr open beach, umm suqeim beach, marina beach, jebel ali beach.
Piercing the sky, the Burj Khalifa dominates Dubai’s landscape and is visible from miles around. The observation deck on the 124th floor opens to some of the most stunning vistas of Dubai and the desert around. It is said that you can watch the sunset twice in the same day at the Burj Khalifa! Take in the views as you enjoy a sundowner at the highest lounge on the planet located on the 154th floor. This is one experience in Dubai you should not miss.
To call Dubai a shopper’s paradise would be quite an understatement. The retail experience in Dubai goes beyond just shopping. Not only do you enjoy amazing discounts, but you’re also a part of an extravaganza that knows how to pamper shoppers. The Dubai Mall , right next to the Burj Khalifa, is the best example of shopping indulgence. You will be spoilt for choice with more than 1,200 shops and 150 restaurants. It also houses an indoor theme park, the Dubai Aquarium and Underwater Zoo, an ice-skating rink and a majestic indoor waterfall. With so much to explore, you can easily spend one whole day at the Dubai Mall.
If any place in Dubai is the seamless blend of the past and the present, it must be the Madinat Jumeirah. Its name translates as ‘ City of Jumeirah ’. This beautiful resort complex by the sea takes its design inspirations from the traditional strongholds of Dubai. It encloses a multitude of private enclaves and luxury hotels built in the traditional style but equipped with all the modern amenities. The best way to explore this luxurious complex is on a traditional wooden arba that takes you around at a leisurely pace.
A captivating water, music and light spectacle in Downtown Dubai, The Dubai Fountain is the world’s tallest performing fountain. At over 900 ft in length – equivalent to over two football pitches – The Dubai Fountain is situated on the 30-acre Burj Lake and performs to a selection of different melodies. The fountain has a unique design comprising five circles of varying sizes and two arcs and features powerful water nozzles that shoot water up to impressive heights. When operational, the fountain has over 22,000 gallons of water in the air at any given moment.
The mall of the Emirates in Dubai is a must visit place on any Dubai tour . It offers multiple entertainment activities to tourists under one roof and is one of the largest malls in the world and has over 630 brands under one roof covering an area of 233,467 sqm. With many fascinating activities in one place such as Magic Planet, VOX Cinemas, Theatre of Rhodes, and the jaw-dropping Ski Dubai, visiting this mall during your Dubai holiday will never disappoint you.
Dubai Aquarium – Unique Underwater Zoo
Dubai Aquarium & Underwater Zoo is home to thousands of aquatic animals, comprising over 140 species. Over 400 Sharks and Rays live in our 10 million litre tank, including Sand Tiger Sharks, Giant Groupers, and a host of other marine species. A series of animal encounters and diving experiences allows visitors to come face-to-face with the aquatic residents. From Small-clawed Asian Otters to Sharks and Rays, there are plenty of memorable moments to be had with your friends and family at Dubai Aquarium & Underwater Zoo during your Dubai holiday.
Dubai is well known as a luxury travel destination, but it is also home to miles and miles of pristine beaches with soft white sands and clear water. These beaches are located on the temperate, aquamarine-blue Persian Gulf that is known for its calm seas and beautiful weather. Make it a point to visit these 5 beaches in Dubai during your Dubai trip.
The biggest beach in Dubai, the massive JBR Open Beach has fluffy white sand and warm, beautiful turquoise waters. Here you can rent jet skis to zip across the waves and scooters to zip across the promenade that lines this beach. Make sure to check it our on your nest Dubai package.
For Insta-worthy pics of the sea with the Burj al Arab in the background, head to Umm Suqeim Beach. Also known as Sunset Beach this wide, flat beach is where the Burj is located. This beach is also one of the few surfing spots in Dubai. A must visit beach on your trip to Dubai.
Kite Beach is very popular with Dubai's foodies as many food trucks assemble here during the day and evening. Also, many little restaurants and cafés line Jumeirah Beach Road, which runs along this beach.
For a luxurious beach experience, head to Marina beach. The Dubai Marina is a luxury residential area and Marina Beach is a section of sandy beach that runs parallel to it. It is a wide, beautiful beach with soft white sand. At Marina beach you're also close to Restaurants, shops, little cafés, and ice-cream shops that line the promenade. Your Dubai holiday is incompletes without a trip to this luxury beach.
Jebel Ali is about 30 minutes south of downtown Dubai and the emirate's newest recreational zone. Home to the world's largest man-made harbour, the area is home to many long, sandy beaches where you can find yourself virtually alone. Besides typical beach activities and water sports, Jebel Ali is a popular dive area.
From hearty and flavourful street food to decadent Michelin-starred creations, you can get it all in Dubai. The flavours of the city will infuse your heart with their sheer variety. Here are our picks of food that you should taste in Dubai.
Stuffed Camel
This dish is a culinary delight that takes hours to make, with ingredients that are remarkably simple. This dish is a must try on your Dubai package. Nothing but salt is added to a pot of wheat and lamb or camel meat, and these are cooked until the texture is smooth and uniform. The resulting mixture slowly baked overnight. The result is nothing short of alchemy. In a land famed for the spice trade, Al Harees is a remarkably simple dish that will Bring delight to your palate during your Dubai trip.
This refreshing pudding is a hit with the kids. Be sure to try some during Your Trip to Dubai with your family. Mehalabiya’s is decadently flavoured with rosewater and pistachios and tastes like a cool, calm desert breeze. It is perfect for those who seek an after-dinner treat that isn’t too sweet. You cannot miss out on this luscious dessert on your Dubai holiday package.
Also called khuzi, this dish consists of a whole-roasted lamb or goat served on kebab skewers with vegetables and hazelnuts over a bed of pilaf or fragrant rice. It is easily one of the most popular dishes in Dubai because it is considered a whole meal in itself. It’s also happens to be the national dish of the United Arab Emirates, which means any Dubai trip without ghuzi is an incomplete one.
Named by the Guinness World Book of Records as the largest foods you can eat, a stuffed camel is one of the most opulent meals you can sit down to on your Dubai holiday.
Cooked on a spit and stuffed with chicken, eggs, fish and even whole sheep stuffed camel is considered a traditional food in Dubai, served at weddings and Bedouin feasts. This meal could very well be the highlight of your Dubai trip. You know, you need to try this on your Dubai holidays!
The best restaurants in Dubai you can eat at during your Dubai holiday are:
- La Petit Maison, Dubai - French/Italian
- Zeng He, Dubai - Modern Chinese
- Zuma Dubai - Japanese
For Indian cuisine on your next trip to Dubai you could visit:
- India by Vineet
- Carnival by Tresind
- Basanti & Co.
Things to Do in Dubai
Dubai is one of those holiday destinations that does not let you sit still. Between its malls, theme parks and beaches, there are a range of activities that will keep you busy on your Dubai holiday. While most of the activities can be done without venturing outside, there are those that cannot be contained indoors. Here are our recommendations of things to do in Dubai.
Visit Ferrari World
Make a splash at wild wadi, ride a hot air balloon, realize your bollywood dreams in dubai, witness a miracle in the desert, frame your dubai holiday, soar over dubai with a zip line.
Get fast and furious at this amusement park in Abu Dhabi. The first Ferrari branded theme park ever built it houses the Ferrari Karting Academy, The Ferrari Store, The Junior Grand Prix, The Mamma Rossella, the turbo Track, The Formula Rossa, The Flying Aces, and much more, Ferrari World has its own adventure to offer. The excitement and thrill you will experience on your Dubai packages with offers.
From the highest loop on the planet to the fastest rollercoaster in the world, twist and turn yourself upside down on these fantastic rides designed to let you have a thrilling experience. If you are thrilled by speed, this is going to be the highlight of your Dubai holiday.
Wild Wadi Water Park in Dubai is world famous and features amongst the best outdoor water parks in West Asia. It also holds the distinction of having housed the largest water slide outside of North America. Taking a day trip to experience the rides, slides and many swimming pools is one of the best things to do in Dubai and guarantees to make your Dubai tour a whole lot cooler.
Soar over the mesmerising Dubai desert away and take a peaceful and relaxing ride in a hot air balloon while you can marvel at the stark landscape.
Take in the hypnotic desert vistas as you soar over the dunes and the occasional oasis on your Dubai package and make it a complete trips. Each basket holds a maximum of 24 people and there’s plenty of room for you and your family. Don't miss this wish to take a break from the fast paced city during your Dubai tour.
Bollywood Parks, Dubai is a larger than life interactive Bollywood theme park that brings alive the magic of Indian cinema and its popular characters while you hunt down Gabbar Singh with a 3D laser. Attend grand musical performances at the magnificent Rajmahal, and soar above the sky in the 4D theatre with ‘Krrish’ as all your Bollywood dreams become a reality.
Don’t miss the Bollywood Boulevard for some chaat and kulfis if you get homesick during your Dubai holiday. A true Bollywood fanatic would not miss this on his Dubai tour.
Dubai always finds ways to enchant you with its stunning architecture and splendid attractions. However, this whopping 72,000-sqm garden blooms with over 150 million flowers based installations takes the cake. The Miracle Garden hosts an award-winning life-size Airbus 380 made up of 500,000 flowers. It also has floral heart passages you can walk through and an 18-meter high Mickey Mouse for a grand photo op. This is one Dubai attraction that will turn your Dubai holiday into a journey for your soul.
Known amongst one of the tallest buildings in the world, Dubai Frame is quite literally a picture frame that has been visited by millions. Situated at a height of 150 metres, it offers beautiful views of the magnificent old and new Dubai, the glimmering water of the Gulf, and shimmer of the sands. A view that must be included on your Dubai tour.
Walking on the spectacular glass bridge, that connects the towers of the frame, gives the feeling of walking on air and is quite a thrilling experience and is one of the most unique things you can do during your Dubai holiday.
Get the best view in all of Dubai with the XLine at Dubai Marina, provided you stop screaming and keep your eyes open. This zipline is the world’s longest urban zipline that lets you see the Dubai Marina beachfront, snazzy high rises, and the vast expanses of the city cruising at a speed of 80 kmph.
You can experience this rush during your solo Dubai tour or in tandem i.e. along with a partner strapped to you.
The 29th edition of the Dubai Shopping Festival is all set to host visitors from across the globe for a shopping extravaganza! Set to begin on 8th December 2023, the Dubai Shopping Festival 2023 will offer spectacular offers until 14th January 2024.
Dubai exudes a different aura and energy during the shopping festival. It is more than just a shopping festival, it is an experience that stays with you for many years. The unique combination of cosmopolitan culture, magnificent skyscrapers, beautiful beaches, extravagant malls, and people from around the world, make Dubai during the shopping festival one of the best destinations in the world.
When it comes to shopping in Dubai, you will be spoilt for options. No surprise then that it is known as a shopper's paradise. Home to the world's largest shopping mall, The Dubai Mall, Dubai is not only about glamour and grandeur. Beneath the modern facade of the city lies an old-world charm of traditional souks where you can find everything from personalized perfumes to gold.
We have made a list of the must-buy things in Dubai so that you can shop without worry!
- Gold Jewellery - The list of shopping in Dubai won't be complete without it, as Dubai is known as the 'City of Gold'. You can pick pretty gold pieces at a lower price compared to other parts of the globe.
- Arabic Attars and Oudh - Both Attars and Oudhs are renowned for their aromatic fragrance and are used widely by Arab men and women. Traditional Oudh has a very distinct smell and is slightly expensive, whereas Attars can be customized by blending scents of your choice.
- Arabic Coffee and Kava Pots - Arabic coffee is pure coffee with a slightly bitter but refreshing taste. If you love coffee, this is one of the best things you can buy in Dubai. The pots are generally made of copper, and these can be used daily or as decorative pieces.
- Arabian Dates - You will find a wide assortment of dates in Dubai. Taste and pick up the ones you like the most. Majdool, Shokari and Ajwa are very popular and tasty.
- Pashmina Shawls - Made from real goats' hair and silk, the price tag is a little heavy on the pocket. You can always choose the viscose or silk versions for an alternative if you are on a budget.
- Persian Rugs - Persian rugs are known for their intricate designs and detailing. The pricing depends on the size, detailing and quality of the rugs. You can also find affordable options in the souk.
- Spices - These are extremely flavourful and are sold at affordable prices in local markets. This is the best way to bring home some authentic Middle Eastern flavours.
- Hookah Pipes - Even though you can find them everywhere, nothing beats the authentic Arab ones. There is a wide range of options to choose from, so be spoiled for choice till you find the perfect piece.
- Arabic Lanterns and Lamps - They are known for their beautiful filigree work and intricate patterns. These lamps are made of glass and often ornamented with beautiful stonework.
- Sweets - There are multiple options to choose from - Baklava, Maamoul and Knafeh, to name a few. These are a must-try when in Dubai.
- Camel Milk Chocolate - This is one of the most delicious things you can bring back from Dubai. Initially only found in Dubai, now it is exported to other countries.
Did you know that Dubai offers its fair share of thrills as well? There are multiple adventurous things to do in Dubai that you must experience while you are there. We offers to Dubai trip to enjoy adventurous activities in Dubai. Here are few Adventurous things to do in Dubai.
- Dune Bashing - This is one of the most popular adventure activities in Dubai and also in demand with families as the minimum age limit is 3 years. You can get into an SUV or a Hummer and get driven around at high speeds while bashing the sand dunes. You can also combine this with a desert safari.
- Sand boarding - It is similar to skiing but in a desert. It is fun to slide down through the sandy dunes of Dubai. It holds one of the top spots in Dubai adventure places. Minimum age limit is 13 years.
- Skydiving - Your Dubai trip is incomplete without watching The Palm Islands. What better to watch it than from an altitude of 14,000 feet above sea level. You will have an instructor with you throughout, so feel the adrenaline rushing while you fall at speeds of 200 kmph. Minimum age limit is 18 years.
- Shark Diving - Fascinated by sharks? Dubai Mall allows you to dive in with the sharks. This mall has a huge aquarium where shark diving takes place, and it's an entirely safe experience to participate in. Minimum age limit is 10 years.
- Zip lining - With the world's longest zip-lining track, it is one of the extreme Dubai adventure places. Located at the height of 1800 feet, you get a panoramic view of the city while cruising at speeds of 60-70kmph. Minimum age limit is 10 years.
- Flyboarding - It is one of the unique and thrilling experiences in Dubai. Imagine flying over the water on a saddle attached to a water propulsion device. You can enjoy the landscape of Dubai while cruising at speeds of 40 kmph.
- Wakeboarding - This involves getting on a wakeboard and gliding through the water. The initial lift requires skills but is easily manageable once you are outside the water. Just maintain a straight posture and lean back while you are on it.
There are many other activities that you can try in Dubai, such as deep-sea fishing, hot air balloon and Dubai helicopter tour, to name a few. There is something for everyone here!
Dubai is a well-known luxury travel destination. With so many resorts in Dubai, there are countless options to choose from. There are multiple luxury hotel brands available, so choosing the best hotel in Dubai for your stay can be a task. We've made a list of the best hotels in Dubai to choose from, so you don't have to wonder about where to stay in Dubai. Our offers on Dubai packages offering the best hotels, sightseeing and other activities.
- Atlantis, The Palm - Nothing defines luxury the way Atlantis does, with signature underwater suites having glass walls. It is located on the top outer edge of the Palm Jumeirah, facing the Persian Gulf. Atlantis also has other attractions such as The Lost Chambers Aquarium, Dolphin Bay, and Aquaventure waterpark.
- Four Seasons Resort Dubai at Jumeirah Beach - Located on the shore of the Arabian Gulf, this resort provides the ultimate five-star experience. From beautiful sea-facing rooms and suites to a host of amenities, you can stay in luxury while indulging yourself in multiple activities.
- Burj Al Arab, Jumeirah - The only seven-star hotel in the world, this luxury resort has its peninsula near the Jumeirah beach. It has 201 duplex apartment suites that come with their private butlers. With multiple cuisines to choose from, this resort has nine restaurants run by the hotel's Michelin-starred culinary team. When you leave the hotel, you can either drive or be driven in a supercar!
- Bulgari Resort Dubai - This resort in Jumeirah Bay Island belongs to the famous Italian jeweller. This embodies luxury, with only 101 rooms and 20 suites. They have their yacht club and marina.
- DoubleTree by Hilton Hotels Dubai - Situated right at the end of JBR's The Walk shopping street, this high-rise resort has no regular rooms. They are all fully-furnished one, two or three-bedroom apartments with a kitchen and patio, making this one of the best hotels in Dubai for families. They have their own private beach, and the resort is very close to the metro station, which also makes it easy to explore the various tourist attractions.
- Sheraton Jumeirah Beach Resort - This mid-range beach resort is located very close to Hilton along JBR's The Walk. They have a large beachfront area and also a huge garden. There are five on-site restaurants to choose from which serve a variety of cuisines such as Chinese, Italian and Middle Eastern. You can also enjoy your meal at the poolside/beachside cafe.
Refine Search:
Must Include Places
Departure City
Price Per Person
Approx price per person
Month of Travel
Package Type
- ( 1 ? 'N':'N' --> ) →
- Optional Flights
Sightseeing
Tour manager, 0 --> rs. 0 --> rs. 0 --> rs. rs. 0) --> % off.
Starting price per adult
Final EMI value will be displayed post the total package cost is calculated
Above points are approximate & calculated for Silver tier members, actual points will be credited basis your membership, after your travel is completed.
- Silver Member - 1%*Total value ( Net )
- Gold Member - 1.5%*Total value ( Net )
For more information, click here
Round trip Flights included
flight optional.
- 1 ? $data.noOfNights+' nights':$data.noOfNights +' night' --> 1 night
How much does a Dubai tour package cost?
Dubai ranks among the top-visited destinations in the world. There are more than 35 Dubai tour packages available at Thomas Cook India. There are packages that can be customized as per the user’s requirements. Also Thomascook have offers on selected dubai tour packages.
What is the best time to plan a Dubai tour?
People love traveling to Dubai all around the year. If you are still looking for the best time for a Dubai tour to enjoy the artificial beaches, outdoor activities, exciting events, and live entertainment. If you like summers, June to August is the best time. Whereas if you want a pleasant climate November to March is recommended for a Dubai trip as The winter season starts to fly.
Which are some of the most visited places on a Dubai trip?
There is an endless list of famous places in Dubai and a plethora of things to do on a Dubai trip. Dubai really has it all, with everything from larger-than-life theme parks to impressive shopping malls. In recent years, Dubai has emerged as one of the most urbane and trendy destinations in the world. In fact, you will either need a month-long vacation or several shorter trips to explore the entire Dubai. Few famous attractions include B urj Khalifa at the top, Legoland, Dubai Aquarium, IMG world of adventure, etc.
What is the most convenient mode of transportation in Dubai?
A very simple answer to that is ‘ Dubai metro ’. The Dubai metro is one of the world's most advanced metro systems and is the most convenient mode of transportation in Dubai. There are also many other modes of transportation which one can choose once in Dubai are taxis, buses, the monorail, and water taxis. To book a cab in Dubai, call a taxi or use Uber or Careem, which are both app-based cab services. If you want to go exploring, you could also rent a taxi.
Will I get a visa on arrival in Dubai?
As an Indian passport holder, you can get a visa on arrival in Dubai for a maximum of 14 days provided you meet the requirements. Simply disembark from your flight at Dubai International Airport and proceed to immigration, where a free 30-day visit visa will be stamped on your passport, and enjoy your Dubai tour.
How long is the flight from Dubai to Mumbai?
The flying time for your Dubai trip from Mumbai is 3hrs 10mins to 3hrs 35mins . The distance from Mumbai to Dubai is approx. 1920 kilometers .
Do female travelers need a hijab in Dubai?
No, ladies traveling to Dubai need not wear a hijab while sightseeing or moving around the city. There no such dress code. However, ladies should cover their heads and shoulders while visiting mosques and certain public places on their Dubai trip.
Can I use my Indian driver's license in Dubai?
No! with the regular Indian driver's license you cannot DRIVE in Dubai, or anywhere else in UAE.
When is the Dubai shopping festival held?
The Dubai festival is now the world's longest-running shopping festival. It begins at the end of December every year and ends by early February. There is a number of activities such as live shows and events, raffles, performing arts, concerts, etc.
Is Dubai open on Fridays?
Fridays are known for Jummah Prayers in Dubai and hence banks, government, and private offices are shut as it is a weekly off. However, all the tourist places, malls, restaurants, shopping centers are open except few shops which shut down for an hour or so. So, if a Friday comes in your Dubai trip, it wouldn’t be a problem.
Is Dubai an expensive city?
Yes, Dubai is an expensive city, but not exorbitantly so for travelers on a holiday. Dubai ranked 58th most expensive city in the world. Yet, the city offers relatively good value for money for all their travelers.
How far is Dubai from Abu Dhabi?
The distance is approximately 170 Kilometres . You can choose the mode of transport accordingly. Buses in Dubai are very comfortable, one can also take a taxi. However, traveling by road or metro is convenient and a better option on a Dubai tour.
What are some of the activities to do in during your Dubai tour
Visiting the BurjKhalifa, go skydiving, have a lake ride at the Dubai Fountain, go on a desert safari with a BBQ meal, ride the rides at the Wild Wadi waterpark, go hot air ballooning, and more are some of the things you can do on your Dubai tour.
What currency is used in Dubai?
The currency in Dubai is the dirham .
How many days is enough to explore when on Dubai tour?
There are no fixed number days to see everything Dubai has to offer. A minimum of Three days, on the other hand, puts you in a comfortable position from which to see some of the city's top attractions.
Is it necessary to exchange money before visiting Dubai?
Yes, having cash before you arrive allows you to obtain transportation and other necessities such as food and drink more quickly and a hassle-free Dubai trip.
Is Dubai a safe place to visit for tourists?
Yes, Dubai is generally safe to visit for tourists since Dubai has a very low crime rate.
All about Dubai
Dubai packages, famous places to visit in dubai, trending india destinations, trending international destinations, dubai flights, dubai packages from city, customized dubai packages.
Click on destination labels to get refined search.
- 1 ? $data.noOfNights+' nights':$data.noOfNights +' night' -->
Get the Best Holiday Planned by Experts!
Enter your contact details and we will plan the best holiday suiting all your requirements.
I hereby accept the Privacy Policy and I authorise Thomas Cook Group Companies to contact me.
Maximum Limit Exceeded!
You can select max 3 packages to compare
I want to holiday in
Tell us what you need? & Let your Holiday expert design package for you.
Dubai Holiday Packages
Explore our holiday package deals in dubai, frequently asked questions.
The activity options are endless with a Dubai holiday package. The spectacular shoreline means you can soak up the sun at one of the many beach clubs, or keep the kids entertained with watersports and a picnic amongst palm trees. True thrill seekers should make a beeline to Dubai Parks and Resorts and IMG World of Adventures, theme parks that are sure to get the adrenaline pumping.
Rides not enough of an adventure? See sand from another angle with a skydiving session over Dubai’s desert, or venture to the 148th floor of the Burj Khalifa for jaw-dropping views across the city.
Keen shoppers will want to bring a second suitcase on their Dubai holiday package – there are 1300 shops in Dubai Mall to discover, where high street sits next to haute couture. There are an additional 630 shops to explore at the Mall of Emirates, but that’s not its main attraction – that would be the indoor ski park!
Before retiring to the hotel included in your Dubai holiday package, you can’t miss the city’s thriving nightlife – think rooftop terraces, international DJs, shisha lounges and busy beach clubs.
IMAGES
COMMENTS
Tips for finding Dubai package deals. There are loads of types of vacations in Dubai and the cost will depend on what type of trip you're taking and for how long you'd like to stay. Here are the latest prices for a 3 night trip for 2 travelers: Top vacation $666; Family vacation $593; Romantic vacation $805; Luxury vacation $759; Budget ...
Book today and enjoy guaranteed savings, low deposits from $199pp, complimentary upgrades and many more extras to make your next vacation truly unforgettable. Simply view our dubai vacation offers below or call our destination specialists on 1-855-358-1505 for further details and to book. 30% saving on stay. Book now.
5 nights from £1,929pp. Half Board. Deluxe Room Ocean with Balcony. Unlimited access to Wild Wadi Waterpark. Travel on selected dates from 24 to 30 October 2024. Return Emirates flights from Manchester. Price based on 2 adults and 2 children.
If you are planning for several days of lazy 'all inclusive' style, don't go anywhere else, with a family then you might be a little bored after a few days. Not much going on in the evening. Reviewed on Apr 15, 2024. Bundle your Dubai flight + hotel & save up to 100% off your flight with Expedia. FREE cancellation on select hotels .
The 40-minute Dubai Silver Air Tour flies you over all the Dubai classics, taking off from either Dubai Creek or Jebel Ali Resort, then cruising along the coastline, giving you a bird's-eye view of The World, Burj Khalifa and Burj Al Arab Jumeirah. Ticket prices from E£ 8,109 per person.
232 Dubai tour packages with 235 reviews Save and compare this adventure. ... My friends & i took the JTR Tour all inclusive of hotel, transportation & activities - Dubai Holidays Deluxe 5N/6D Oct 2-6, 2023 and had a blast. We stayed at First Central Hotel Suites in Dubai. ... December 2024. 124. January 2025. 94. February 2025. 82. March 2025 ...
Compare Dubai tours & packages from top Travel agents. Oct 01, 2023: Global Village Dubai is open from 18 October 2023 to 28 April 2024 and Miracle Garden Dubai is open from 29th September 2023 to 30th April 2024. About Dubai Tourism: Known as one of the megacities of the world, Dubai is also one of the top tourist destinations due to its ...
With the In-depth Cultural tour Dubai Luxury Holidays Package 6 Night 7 Days, you have a 7 days tour package taking you through Dubai, United Arab Emirates and Abu Dhabi,. Dubai Luxury Holidays Package 6 Night 7 Days includes accommodation in a hotel as well as an expert guide, meals, transport. Day 5 Multiple Tours - Choose One Tour from list.
With the Explorer tour Magical Dubai, you have a 8 days tour package taking you through Dubai, United Arab Emirates and 3 other destinations in United Arab Emirates. Magical Dubai includes accommodation in a hotel as well as an expert guide, meals, transport and more. ... December 18th, 2023. Unfortunately we didn't get to the tour, because ...
Experience the vibrant city of Dubai with our carefully curated Dubai tour packages. Our Dubai packages offer a range of exciting activities, from exhilarating desert safaris and city tours to shopping extravaganzas at world-renowned malls. Discover iconic landmarks such as the Burj Khalifa, Dubai Mall, and Palm Jumeirah, and immerse yourself in the unique culture and traditions of the UAE.
Glistening skyscrapers and stunning deserts. Book a Dubai package with On The Go Tours. If you are passing through Dubai en route to another one of our destinations, take the opportunity to explore this fascinating city with our 4-day Dubai package Home to the world's tallest building in the Burj Khalifa and other incredible buildings such as the Burj al Arab hotel, Dubai is an exceptional city.
Dubai Tour Packages - Discover exclusive offers on Dubai packages with Holidays Crowd. Strategize your Dubai getaway and select tailored affordable Dubai holiday packages. ... Best Dubai Tour Packages in 2023 . Dubai Packages Day/Night Inclusions Price; Dubai Shopping Spectacular DSF Special Package: 6 Days/5 Nights: ... 3 December 2023. View more.
DAY 3 - December 18 - FREE Day. Enjoy a day of shopping, take a tour of the city, visit a museum, or take advantage of the gorgeous weather by relaxing and having a beach day. DAY 4 - December 19 - Today, will enjoy Dubai's skyline from the comfort of a private yacht. We will cruise and relax as we sail along the marina and Arabian ...
The cost for Dubai Visa ranges from Rs 6,500 to 7,500. According to the new Dubai Visa policy, Indian citizens can get visa on-arrival valid for 14 days if they hold a residence visa for UK or EU countries. All you need to do is to fill a form on arrival and pay an approximate sum of Rs 2,250. Q.
Explore vibrant Dubai and an unforgettable desert adventure before jetting to the Maldives to spend your days lounging on a white-sand beach and snorkeling in the reef. Duration: 12 Days. Prices From: US$ 5,125. Trip Type: Beach & Island Escapes, Luxury and Beyond, Romance & Honeymoon.
5 nights from €2,169pp. Half Board. Deluxe Room Ocean with Balcony. Unlimited access to Wild Wadi Waterpark. Travel on selected dates from 24 to 30 October 2024. Return Emirates flights from Dublin. Price based on 2 adults and 2 children.
We offer 54 tours, trips and vacation packages to Dubai in December 2024. Our Dubai in December 2024 tour packages and trips have 74 customer reviews. All the Dubai December 2024 tour packages and trips are carried out by hand-picked, qualified local and international Dubai tour operators. 54 Trips in Dubai during December 2024. Starts Dubai, UAE.
Best offers on Dubai holiday tour packages from India at Veena World. Click to book Dubai travel packages & get exciting deals on Dubai vacation packages! Call. Toll free number. 1800 22 7979. You can also call on: +91 22 2101 7979 +91 22 2101 6969. Chat on WhatsApp +91 88799 00414. Business hours.
Compare 85 tours of United Arab Emirates in December 2024 with real customer reviews and flexible booking options. Biggest Selection. Best Prices. ... Ultimate Dubai City Package in 3, 4 or 5* Hotels. 3.7 (3 reviews) ... 2023. 5. This was an amazing trip Show more Show less.
Flights Holidays Cars Tours Cruises Deals More. Flights Holidays Tours Cruises Deals. Get a Quote Stores. 0877 40 50 00. Dubai Holiday Deals. Deals for everyone. See all. Explore holidays by interest. ... More about Dubai Deals. Holidays. Home. Holidays. Dubai. Create your own trip. Flights. Tours. Car Hire. Site quick links.
4 Nights 5 Days. Rs.24 094. Plan your Dubai Tour with Thomas Cook. Why Choose Dubai Tour Packages from Us. Every Dubai holiday package is a curated collection of experiences put together by the travel experts at Thomas Cook India, who are themselves, seasoned travellers, having taken a Dubai holiday many times.
Dubai Secluded One&Only Opulence on Palm Jumeirah with Private Beach. 3 nights from. A$2,481 /room. Includes taxes & fees. Stays from 1 available. Price details. View offer. Hotel + flights package available. Dubai Holiday Package deals for travel in 2024/2025.